MC4R Protein, Mouse (Cell-Free, His)

MC4R is a receptor for adrenocorticotropic hormone and α, β, and γ-MSH and plays a key role in regulating energy homeostasis and somatic cell growth. Mediated by G proteins, it forms disulfide-linked homodimers and higher-order oligomers. MC4R Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived MC4R protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of MC4R Protein, Mouse (Cell-Free, His) is 332 a.a., with molecular weight of 43.0 kDa.

MC4R, a receptor specific to the heptapeptide core shared by adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH, plays a pivotal role in regulating energy homeostasis and somatic growth. Mediated by G proteins that stimulate adenylate cyclase to generate cAMP, this receptor forms homodimers that are disulfide-linked and can further assemble into higher-order oligomers. MC4R interacts with ATRNL1 and engages in an interaction with MGRN1, inhibiting agonist-induced cAMP production by competing with GNAS-binding. Additionally, it forms complexes with MRAP and MRAP2, enhancing ligand sensitivity and cAMP generation, thereby contributing to its multifaceted regulatory functions.

Mouse

E. coli Cell-free

N-10*His

P56450 (M1-Y332)

17202

MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTNMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELSSRY

43.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.