MC4R Protein, Mouse (Cell-Free, His)
MC4R is a receptor for adrenocorticotropic hormone and α, β, and γ-MSH and plays a key role in regulating energy homeostasis and somatic cell growth. Mediated by G proteins, it forms disulfide-linked homodimers and higher-order oligomers. MC4R Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived MC4R protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of MC4R Protein, Mouse (Cell-Free, His) is 332 a.a., with molecular weight of 43.0 kDa.
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MC4R is a receptor for adrenocorticotropic hormone and α, β, and γ-MSH and plays a key role in regulating energy homeostasis and somatic cell growth. Mediated by G proteins, it forms disulfide-linked homodimers and higher-order oligomers. MC4R Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived MC4R protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of MC4R Protein, Mouse (Cell-Free, His) is 332 a.a., with molecular weight of 43.0 kDa.
MC4R, a receptor specific to the heptapeptide core shared by adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH, plays a pivotal role in regulating energy homeostasis and somatic growth. Mediated by G proteins that stimulate adenylate cyclase to generate cAMP, this receptor forms homodimers that are disulfide-linked and can further assemble into higher-order oligomers. MC4R interacts with ATRNL1 and engages in an interaction with MGRN1, inhibiting agonist-induced cAMP production by competing with GNAS-binding. Additionally, it forms complexes with MRAP and MRAP2, enhancing ligand sensitivity and cAMP generation, thereby contributing to its multifaceted regulatory functions.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P56450 (M1-Y332)
-
Gene ID17202
-
Molecular Construction
-
N-term
-
10*His
-
MC4R (M1-Y332)
Accession # P56450 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MC4R; Mutated Melanocortin Receptor 4; Melanocortin 4 Receptor; Mutant Melanocortin-4 Receptor; Melanocortin Receptor 4; BMIQ20; MC4-R
-
AA Sequence
MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTNMKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPLIYALRSQELRKTFKEIICFYPLGGICELSSRY
-
Predicted Molecular Mass
43.0 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
