1. Recombinant Proteins
  2. Others
  3. MD-2/LY96 Protein, Human (142a.a, His)

MD2 protein binds bacterial lipopolysaccharide (LPS) and collaborates with TLR4 in the innate immune response to LPS. It also interacts with TLR2 in the response to cell wall components from bacteria. MD2 enhances TLR4-dependent NF-kappa-B activation and forms a heterogeneous homomer, participating in a multi-protein complex with CD14 and TLR4. Ligand binding induces complex oligomerization, crucial for the cellular response to LPS. MD-2/LY96 Protein, Human (142a.a, His) is the recombinant human-derived MD2 protein, expressed by E. coli , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
20 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE MD-2/LY96 Protein, Human (142a.a, His)

  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

MD2 protein binds bacterial lipopolysaccharide (LPS) and collaborates with TLR4 in the innate immune response to LPS. It also interacts with TLR2 in the response to cell wall components from bacteria. MD2 enhances TLR4-dependent NF-kappa-B activation and forms a heterogeneous homomer, participating in a multi-protein complex with CD14 and TLR4. Ligand binding induces complex oligomerization, crucial for the cellular response to LPS. MD-2/LY96 Protein, Human (142a.a, His) is the recombinant human-derived MD2 protein, expressed by E. coli , with C-His labeled tag.

Background

MD2 Protein, a key player in the innate immune response, serves as a critical component in recognizing bacterial lipopolysaccharide (LPS) and coordinating immune reactions. It binds directly to LPS and collaborates with TLR4 to elicit the innate immune response to bacterial LPS. Moreover, MD2 works in tandem with TLR2, responding to cell wall components from both Gram-positive and Gram-negative bacteria. MD2's interaction with TLR4 enhances NF-kappa-B activation, emphasizing its role in signaling pathways. In cell contexts expressing both LY96 and TLR4, MD2 enables responsiveness to LPS, underlining its importance in the cellular recognition of bacterial components. Structurally, MD2 forms a heterogeneous homomer from homodimers linked by disulfide bonds and is a crucial component of the lipopolysaccharide (LPS) receptor complex, which includes at least CD14, LY96, and TLR4. MD2's ligand binding induces interactions with TLR4 and promotes the oligomerization of the complex, further highlighting its central role in the immune response to bacterial challenges.

Actividad biológica

Immobilized Human TLR-4 at 2 μg/mL (100 μL/well) can bind Biotinylated Human MD2. The ED50 for this effect is 0.08207 μg/mL.

  • Immobilized Human TLR-4 at 2 μg/mL (100 μL/well) can bind Biotinylated Human MD2. The ED50 for this effect is 0.08207 μg/mL.
Species

Human

Source

E. coli

Tag

C-8*His

Accession

Q9Y6Y9-1 (Q19-N160)

Gene ID
Molecular Construction
N-term
MD2 (Q19-N160)
Accession # Q9Y6Y9-1
8*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Lymphocyte antigen 96; LY96; Ly-96; ESOP1; ESOP-1; MD-2;
AA Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Predicted Molecular Mass
18 kDa
Peso molecular

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCL, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias

MD-2/LY96 Protein, Human (142a.a, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

MD-2/LY96 Protein, Human (142a.a, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
MD-2/LY96 Protein, Human (142a.a, His)
Cat. No.:
HY-P701067
Cantidad:
MCE Japan Authorized Agent: