Melanotransferrin/CD228 Protein, Mouse (HEK293, Fc)

Melanotransferrin/CD228 protein is involved in cellular iron uptake, undergoing internalization and recycling to the cell membrane. Each subunit binds a single iron atom, suggesting a role in intracellular iron transport. Melanotransferrin/CD228 also exhibits potential zinc binding, showcasing versatile metal ion interactions. Melanotransferrin/CD228 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Melanotransferrin/CD228 protein, expressed by HEK293 , with C-hFc labeled tag.

Melanotransferrin/CD228 protein is implicated in cellular iron uptake, where it appears to undergo internalization and subsequent recycling back to the cell membrane. Each subunit of this protein has the capacity to bind a single atom of iron, suggesting its role in intracellular iron transport. Additionally, Melanotransferrin/CD228 could potentially bind zinc, indicating a versatility in metal ion binding capabilities.

Mouse

HEK293

C-hFc

Q9R0R1 (V20-Q708)

30060  [NCBI]

Partial

VMEVQWCTISDAEQQKCKDMSEAFQGAGIRPSLLCVQGNSADHCVQLIKEQKADAITLDGGAIYEAGKEHGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVTINTLKGVKSCHTGINRTVGWNVPVGYLVESGHLSVMGCDVLKAVGDYFGGSCVPGTGETSHSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGNTLPSWGKSLMSEDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRGDMDGGLIFQLLNEGQLLFSHEDSSFQMFSSKAYSQKNLLFKDSTLELVPIATQNYEAWLGQEYLQAMKGLLCDPNRLPHYLRWCVLSAPEIQKCGDMAVAFSRQNLKPEIQCVSAESPEHCMEQIQAGHTDAVTLRGEDIYRAGKVYGLVPAAGELYAEEDRSNSYFVVAVARRDSSYSFTLDELRGKRSCHPYLGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSQFFNASCVPVNNPKNYPSALCALCVGDEKGRNKCVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTVFENTNGHNPEPWASHLRWQDYELLCPNGARAEVDQFQACNLAQMPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFQMFDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQ

Approximately 100 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/bel-7402-cell.html  [Content Brief]