MIF Protein, Human

MIF Protein, Human has assumed an important role as a pivotal regulator of innate immunity. MIF Protein, Human promotes the pro-inflammatory functions of immune cells.

Macrophage Migration Inhibitory Factor (MIF) has assumed an important role as a pivotal regulator of innate immunity. MIF is an integral component of the host antimicrobial alarm system and stress response that promotes the pro-inflammatory functions of immune cells. MIF-directed therapies might offer new treatment opportunities for human diseases in the future^[1].

Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED₅₀ this effect is ≤19.31 ng/mL, corresponding to a specific activity is ≥5.179×10⁴ U/mg.

• 
  Measured by its ability to inhibit THP-1 human acute monocyte migration .The ED₅₀ for this effect is 9.997 ng/mL, corresponding to a specific activity is 1.0×10⁵ U/mg.

Human

E. coli

Tag Free

P14174 (M1-A115)

4282  [NCBI]

Full Length

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/mt4-cell.html  [Content Brief]

  [2]. Calandra T, et al. Macrophage migration inhibitory factor: a regulator of innate immunity. Nat Rev Immunol. 2003 Oct;3(10):791-800.  [Content Brief]