1. Recombinant Proteins
  2. Others
  3. Minor allergen Can f 2 protein, Dog (His-SUMO)

Minor allergen Can f 2 protein, Dog (His-SUMO)

Cat. No.: HY-P71525
Handling Instructions Technical Support

The Minor allergen Can f 2 protein is found in tongue epithelial tissue and the parotid gland. Minor allergen Can f 2 protein, Dog (His-SUMO) is the recombinant dog-derived Minor allergen Can f 2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The Minor allergen Can f 2 protein is found in tongue epithelial tissue and the parotid gland. Minor allergen Can f 2 protein, Dog (His-SUMO) is the recombinant dog-derived Minor allergen Can f 2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

The Minor allergen Can f 2 protein is localized in tongue epithelial tissue and the parotid gland.

Species

Dog

Source

E. coli

Tag

N-His;N-SUMO

Accession

O18874 (Q19-D180)

Gene ID

403829  [NCBI]

Molecular Construction
N-term
6*His-SUMO
Can f 2 (Q19-D180)
Accession # O18874
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Minor allergen Can f 2; Allergen Dog 2; allergen Can f 2
AA Sequence

QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD

Predicted Molecular Mass
34.4 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Minor allergen Can f 2 protein, Dog (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Minor allergen Can f 2 protein, Dog (His-SUMO)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Minor allergen Can f 2 protein, Dog (His-SUMO)
Cat. No.:
HY-P71525
수량:
MCE Japan Authorized Agent: