MOB1A Protein, Human (His)

In the Hippo signaling pathway, MOB1A serves as a vital activator, governing organ size and suppressing tumors by modulating proliferation and apoptosis. Acting in a kinase cascade, MOB1A, along with STK3/MST2 and STK4/MST1, phosphorylates and activates LATS1/2, influencing the YAP1 oncoprotein and WWTR1/TAZ. This orchestrated phosphorylation controls gene expression pivotal for cell processes. Additionally, MOB1A stimulates STK38 and STK38L kinase activity, cooperating with STK3/MST2 and forming intricate interactions with key pathway components, contributing to its complex regulatory network. MOB1A Protein, Human (His) is the recombinant human-derived MOB1A protein, expressed by E. coli, with C-6*His labeled tag. The total length of MOB1A Protein, Human (His) is 215 a.a., with molecular weight of ~29.0 kDa.

MOB1A, a key activator in the Hippo signaling pathway, plays a crucial role in regulating organ size and suppressing tumors by modulating proliferation and apoptosis. This pathway's core involves a kinase cascade, where STK3/MST2 and STK4/MST1, in complex with the regulatory protein SAV1, phosphorylate and activate LATS1/2 in conjunction with its regulatory partner MOB1. Subsequently, MOB1 phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. This phosphorylation of YAP1 prevents its translocation into the nucleus, thereby controlling the expression of genes crucial for cell proliferation, death, and migration. MOB1A also stimulates the kinase activity of STK38 and STK38L, working cooperatively with STK3/MST2 to activate STK38. Moreover, MOB1A forms intricate interactions with STK38, STK38L, LATS1, and LATS2, contributing to the complex regulatory network within the Hippo signaling pathway.

Human

E. coli

C-6*His

Q9H8S9 (S2-R216)

55233  [NCBI]

SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Approximately 29.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.