MTHFS Protein, Human (His)

MTHFS proteins play a critical role in tetrahydrofolate metabolism and help regulate carbon flow within the folate-dependent one-carbon metabolic network. This network is critical for providing the carbon units required for purine, thymidine, and amino acid biosynthesis. MTHFS Protein, Human (His) is the recombinant human-derived MTHFS protein, expressed by E. coli , with C-6*His labeled tag. The total length of MTHFS Protein, Human (His) is 203 a.a., with molecular weight of ~28.0 kDa.

The MTHFS protein is integral to tetrahydrofolate metabolism, playing a pivotal role in the regulation of carbon flow within the folate-dependent one-carbon metabolic network. This network is essential for supplying carbon needed in the biosynthesis of critical cellular components, including purines, thymidine, and amino acids. Notably, MTHFS catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) into 5,10-methenyltetrahydrofolate, a crucial step in the folate cycle. This enzymatic activity underscores its significance in directing one-carbon units for various cellular processes. The MTHFS protein's contribution to maintaining the balance and availability of carbon intermediates is fundamental to cellular metabolism and supports essential biosynthetic pathways (

Human

E. coli

C-6*His

P49914 (M1-A203)

10588  [NCBI]

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA

Approximately 28.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.