MTHFS Protein, Human (His)
MTHFS proteins play a critical role in tetrahydrofolate metabolism and help regulate carbon flow within the folate-dependent one-carbon metabolic network. This network is critical for providing the carbon units required for purine, thymidine, and amino acid biosynthesis. MTHFS Protein, Human (His) is the recombinant human-derived MTHFS protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MTHFS proteins play a critical role in tetrahydrofolate metabolism and help regulate carbon flow within the folate-dependent one-carbon metabolic network. This network is critical for providing the carbon units required for purine, thymidine, and amino acid biosynthesis. MTHFS Protein, Human (His) is the recombinant human-derived MTHFS protein, expressed by E. coli , with C-6*His labeled tag.
The MTHFS protein is integral to tetrahydrofolate metabolism, playing a pivotal role in the regulation of carbon flow within the folate-dependent one-carbon metabolic network. This network is essential for supplying carbon needed in the biosynthesis of critical cellular components, including purines, thymidine, and amino acids. Notably, MTHFS catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) into 5,10-methenyltetrahydrofolate, a crucial step in the folate cycle. This enzymatic activity underscores its significance in directing one-carbon units for various cellular processes. The MTHFS protein's contribution to maintaining the balance and availability of carbon intermediates is fundamental to cellular metabolism and supports essential biosynthetic pathways (
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P49914-1 (M1-A203)
-
Molecular Construction
-
N-term
-
MTHFS (M1-A203)
Accession # P49914-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MTHFS; Methenyl-THF Synthetase; Methenyltetrahydrofolate Synthetase; 5,10-Methenyl-Tetrahydrofolate Synthetase; 5-Formyltetrahydrofolate Cyclo-Ligase; 5,10-Methenyltetrahydrofolate Synthetase; HsT19268; NEDMEHM; 5,10-Methenyltetrahydrofolate Synthetase (5
-
AA Sequence
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
-
Predicted Molecular Mass
24.3 kDa
-
Molecular Weight
Approximately 24-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
