1. Recombinant Proteins
  2. Others
  3. Mucin-15/MUC15 Protein, Cynomolgus (HEK293, Fc)

Mucin-15/MUC15 Protein, Cynomolgus (HEK293, Fc)

Cat. No.: HY-P78578
Handling Instructions Technical Support

MUC15 is a membrane-bound mucin. The human MUC15 protein contains an extracelluar domain, a small transmembrane domain, and a highly conserved cytoplasmic tail. MUC15 overexpression suppresses trophoblast-like cell invasion. Mucin-15/MUC15 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived Mucin-15/MUC15 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MUC15 is a membrane-bound mucin. The human MUC15 protein contains an extracelluar domain, a small transmembrane domain, and a highly conserved cytoplasmic tail. MUC15 overexpression suppresses trophoblast-like cell invasion[1][2]. Mucin-15/MUC15 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived Mucin-15/MUC15 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

MUC15 (mucin) was characterized because of its association with the bovine milk fat globule membrane (MFGM). It was shown to be a 33.3-kDa (307 AA) protein comprising an extracellular mucin domain rich in Ser, Thr, and Pro residues, a type 1 membrane-spanning domain, and a short cytoplasmic tail. In SDS-PAGE, bovine MUC15 migrates as a 115- to 130-kDa protein, which reflects its massive glycosylation (both N- and O-glycans). The corresponding cDNA of human MUC15 encodes an unprocessed protein of 334 AA showing 67% sequence similarity with the bovine counterpart[1].
The membrane-bound mucins, which are type I membrane proteins, include MUC1, MUC3, MUC4, MUC12, MUC13, MUC15, MUC16, MUC17, and MUC20. Overexpression of MUC15 substantially decreased matrigel invasion of JAR and JEG-3 cells by 87.5 ± 1.1 and 83.8 ± 5.7%, respectively. The low levels of MUC15 expression may be critical for trophoblast invasion in early placental development, whereas high levels of MUC15 expression may provide a suppressive signal for trophoblast invasion at the end of gestation[2].

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

XP_005541632.1 (L254-G373)

Gene ID
Molecular Construction
N-term
Mucin-15 (L254-G373)
Accession # XP_005541632.1
hFc
C-term
Synonyms
Mucin 1; MUC1; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; SEC; MUC-1; X; MUC1; ZD; PEM; PEMT; PUM; CA15-3; Episialin
AA Sequence

LSLGVSFFFLSFHISNLQFNSSLEDPSTNYYQQLQRDISELFLQIYKQGDFLGLSNIMFRPGSVVVQSTLVFREGTTNVHDVETQFNQRKTEAASRYNLTISDISVRDVPFPFSAQTGAG

Molecular Weight

Approximately 48 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Mucin-15/MUC15 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Mucin-15/MUC15 Protein, Cynomolgus (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mucin-15/MUC15 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P78578
Quantity:
MCE Japan Authorized Agent: