MUSTN1 Protein, Human (His)
Based on 1 Customer Validation
The MUSTN1 protein emerged as a potential regulator of musculoskeletal development and regeneration, coordinating key molecular events. Its specificity highlights its role in the complex signaling pathways that control musculoskeletal tissue. MUSTN1 Protein, Human (His) is the recombinant human-derived MUSTN1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The MUSTN1 protein emerged as a potential regulator of musculoskeletal development and regeneration, coordinating key molecular events. Its specificity highlights its role in the complex signaling pathways that control musculoskeletal tissue. MUSTN1 Protein, Human (His) is the recombinant human-derived MUSTN1 protein, expressed by E. coli , with N-His labeled tag.
Background
MUSTN1 Protein emerges as a potential player in the dynamic processes underlying the development and regeneration of the musculoskeletal system. Its implication suggests a crucial role in orchestrating the intricate molecular events that govern the formation and renewal of musculoskeletal tissues. The specificity of MUSTN1's involvement highlights its potential as a key regulator in the complex network of signaling pathways that contribute to musculoskeletal development and regeneration. Unraveling the precise mechanisms through which MUSTN1 functions could provide valuable insights into its role in cellular differentiation, tissue formation, and the broader processes essential for the maintenance and repair of the musculoskeletal system. Exploring the functional significance of MUSTN1 in these contexts holds promise for advancing our understanding of musculoskeletal biology and may open avenues for therapeutic interventions in conditions related to musculoskeletal development and regeneration.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q8IVN3 (M1-G82)
-
Molecular Construction
-
N-term
-
His
-
MUSTN1 (M1-G82)
Accession # Q8IVN3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MUSTN1; Mustang; Musculoskeletal, Embryonic Nuclear Protein 1; Musculoskeletal Temporally Activated Novel; Musculoskeletal Embryonic Nuclear Protein 1
-
AA Sequence
MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)