MutT Protein, E.coli (His-SUMO)
The MutT protein maintains the genome by hydrolyzing 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. Integrity plays a key role. This prevents misincorporation of 8-oxoGua into DNA and RNA, ensuring the fidelity of the nucleotide library. MutT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived MutT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The MutT protein maintains the genome by hydrolyzing 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. Integrity plays a key role. This prevents misincorporation of 8-oxoGua into DNA and RNA, ensuring the fidelity of the nucleotide library. MutT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived MutT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
MutT protein plays a pivotal role in maintaining genomic integrity by specifically hydrolyzing both 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. This enzymatic activity is crucial for preventing the misincorporation of 8-oxoGua into DNA and RNA, thereby ensuring the fidelity of nucleotide pools. MutT's ability to remove oxidatively damaged guanine, specifically 8-oxo-dGTP, from DNA and nucleotide pools prevents replicational errors, particularly A.T to G.C transversions. Additionally, MutT may contribute to transcriptional fidelity by cleaning up 8-oxo-GTP from the ribonucleotide triphosphate pool, although its impact on transcriptional fidelity is likely limited due to the lower efficiency of RNA polymerase in incorporating 8-oxo-GTP. Furthermore, MutT demonstrates versatility by hydrolyzing 8-oxo-dGDP and 8-oxo-GDP to their monophosphate forms and can, to a lesser extent, process various nucleoside di- and triphosphates. Collaborating with MutM and MutY, MutT acts cooperatively to prevent the accumulation of oxidized guanine residues in DNA, highlighting its essential role in maintaining the integrity of the genetic material.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
P08337 (M1-L129)
-
Gene ID944824 [NCBI]
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
MutT (M1-L129)
Accession # P08337 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
8-oxo-dGTP diphosphatase; EC:3.6.1.55; 8-oxo-dGTPase; 7,8-dihydro-8-oxoguanine-triphosphatase; Mutator protein MutT; dGTP pyrophosphohydrolase; mutT; JW0097; b0099
-
AA Sequence
MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
-
Predicted Molecular Mass
30.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)