MutT Protein, E.coli (His-SUMO)

The MutT protein maintains the genome by hydrolyzing 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. Integrity plays a key role. This prevents misincorporation of 8-oxoGua into DNA and RNA, ensuring the fidelity of the nucleotide library. MutT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived MutT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The MutT protein maintains the genome by hydrolyzing 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. Integrity plays a key role. This prevents misincorporation of 8-oxoGua into DNA and RNA, ensuring the fidelity of the nucleotide library. MutT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived MutT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

MutT protein plays a pivotal role in maintaining genomic integrity by specifically hydrolyzing both 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. This enzymatic activity is crucial for preventing the misincorporation of 8-oxoGua into DNA and RNA, thereby ensuring the fidelity of nucleotide pools. MutT's ability to remove oxidatively damaged guanine, specifically 8-oxo-dGTP, from DNA and nucleotide pools prevents replicational errors, particularly A.T to G.C transversions. Additionally, MutT may contribute to transcriptional fidelity by cleaning up 8-oxo-GTP from the ribonucleotide triphosphate pool, although its impact on transcriptional fidelity is likely limited due to the lower efficiency of RNA polymerase in incorporating 8-oxo-GTP. Furthermore, MutT demonstrates versatility by hydrolyzing 8-oxo-dGDP and 8-oxo-GDP to their monophosphate forms and can, to a lesser extent, process various nucleoside di- and triphosphates. Collaborating with MutM and MutY, MutT acts cooperatively to prevent the accumulation of oxidized guanine residues in DNA, highlighting its essential role in maintaining the integrity of the genetic material.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • MutT (M1-L129)
      Accession # P08337
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    8-oxo-dGTP diphosphatase; EC:3.6.1.55; 8-oxo-dGTPase; 7,8-dihydro-8-oxoguanine-triphosphatase; Mutator protein MutT; dGTP pyrophosphohydrolase; mutT; JW0097; b0099

  • AA Sequence

    MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL

  • Predicted Molecular Mass

    30.9 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00