1. Recombinant Proteins
  2. Others
  3. Myelin protein P0/MPZ Protein, Human (HEK293, His)

Myelin protein P0/MPZ Protein, Human (HEK293, His)

Cat. No.: HY-P70328
Handling Instructions Technical Support

Myelin protein P0 (MPZ) is a crucial adhesion molecule essential for normal myelination in the peripheral nervous system. Acting as an adhesion mediator between adjacent myelin wraps, MPZ plays a pivotal role in myelin compaction. Its homodimeric and homotetrameric structures underscore its significance in establishing necessary cellular interactions for myelin formation and integrity in the peripheral nervous system. Myelin protein P0/MPZ Protein, Human (HEK293, His) is the recombinant human-derived Myelin protein P0/MPZ protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Myelin protein P0 (MPZ) is a crucial adhesion molecule essential for normal myelination in the peripheral nervous system. Acting as an adhesion mediator between adjacent myelin wraps, MPZ plays a pivotal role in myelin compaction. Its homodimeric and homotetrameric structures underscore its significance in establishing necessary cellular interactions for myelin formation and integrity in the peripheral nervous system. Myelin protein P0/MPZ Protein, Human (HEK293, His) is the recombinant human-derived Myelin protein P0/MPZ protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Myelin protein P0 (MPZ) emerges as a crucial adhesion molecule, essential for the normal myelination process within the peripheral nervous system. Functioning as a mediator of adhesion between adjacent myelin wraps, MPZ plays a pivotal role in facilitating the intricate process of myelin compaction. Its homodimeric and homotetrameric structures further underscore its significance in establishing the necessary cellular interactions that contribute to the formation and integrity of myelin in the peripheral nervous system.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P25189-1 (I30-R153)

Gene ID
Molecular Construction
N-term
MPZ (I30-R153)
Accession # P25189-1
6*His
C-term
Synonyms
rHuMyelin protein P0/MPZ, His; Myelin Protein P0; Myelin Peripheral Protein; MPP; Myelin Protein Zero; MPZ
AA Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTR

Molecular Weight

14-17 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Myelin protein P0/MPZ Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Myelin protein P0/MPZ Protein, Human (HEK293, His)
Cat. No.:
HY-P70328
Quantity:
MCE Japan Authorized Agent: