Myelin protein P0/MPZ Protein, Human (HEK293, His)

Myelin protein P0 (MPZ) is a crucial adhesion molecule essential for normal myelination in the peripheral nervous system. Acting as an adhesion mediator between adjacent myelin wraps, MPZ plays a pivotal role in myelin compaction. Its homodimeric and homotetrameric structures underscore its significance in establishing necessary cellular interactions for myelin formation and integrity in the peripheral nervous system. Myelin protein P0/MPZ Protein, Human (HEK293, His) is the recombinant human-derived Myelin protein P0/MPZ protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Myelin protein P0/MPZ Protein, Human (HEK293, His) is 124 a.a., with molecular weight of 14-17 kDa.

Myelin protein P0 (MPZ) emerges as a crucial adhesion molecule, essential for the normal myelination process within the peripheral nervous system. Functioning as a mediator of adhesion between adjacent myelin wraps, MPZ plays a pivotal role in facilitating the intricate process of myelin compaction. Its homodimeric and homotetrameric structures further underscore its significance in establishing the necessary cellular interactions that contribute to the formation and integrity of myelin in the peripheral nervous system.

Human

HEK293

C-6*His

P25189 (I30-R153)

4359  [NCBI]

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTR

14-17 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.