MYOZ2 Protein, Human (His)
MYOZ2 is a member of the Myozenin family that binds to Z-line proteins, including α-actin and γ-filamin, and contributes to the localization of calcineurin signals within the sarcomere. It plays a key role in regulating calcineurin signaling and has been shown to be involved in muscle regulatory mechanisms and myofibril formation. MYOZ2 Protein, Human (His) is the recombinant human-derived MYOZ2 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MYOZ2 is a member of the Myozenin family that binds to Z-line proteins, including α-actin and γ-filamin, and contributes to the localization of calcineurin signals within the sarcomere. It plays a key role in regulating calcineurin signaling and has been shown to be involved in muscle regulatory mechanisms and myofibril formation. MYOZ2 Protein, Human (His) is the recombinant human-derived MYOZ2 protein, expressed by E. coli , with C-6*His labeled tag.
MYOZ2, a member of the Myozenin family, functions as an intracellular binding protein, facilitating the linkage of Z-line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, and LDB3/ZASP, thereby contributing to the localization of calcineurin signaling within the sarcomere. This protein is pivotal in modulating calcineurin signaling, suggesting its involvement in the intricate regulatory mechanisms of muscle function. Additionally, MYOZ2 may play a crucial role in myofibrillogenesis. Through its C-terminus, MYOZ2 interacts with spectrin repeats 3 and 4 of ACTN2, and it engages in interactions with other proteins, including ACTN1, LDB3, MYOT, and PPP3CA. These interactions highlight the significance of MYOZ2 in mediating molecular connections essential for the structural and signaling integrity of the sarcomere.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9NPC6 (M1-L264)
-
Molecular Construction
-
N-term
-
MYOZ2 (M1-L264)
Accession # Q9NPC6 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
MYOZ2; Myozenin-2; Prev. C4orf5; Chromosome 4 Open Reading Frame 5; FATZ-2; Alternative Protein MYOZ2; CS-1; Muscle-Specific Protein; FATZ-Related Protein 2; CMH16; Calsarcin-1; Myozenin 2; Calcineurin-Binding Protein Calsarcin-1
-
AA Sequence
MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL
-
Predicted Molecular Mass
30.9 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
