MYOZ2 Protein, Human (His)

MYOZ2 is a member of the Myozenin family that binds to Z-line proteins, including α-actin and γ-filamin, and contributes to the localization of calcineurin signals within the sarcomere. It plays a key role in regulating calcineurin signaling and has been shown to be involved in muscle regulatory mechanisms and myofibril formation. MYOZ2 Protein, Human (His) is the recombinant human-derived MYOZ2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of MYOZ2 Protein, Human (His) is 264 a.a., with molecular weight of ~38.0 kDa.

MYOZ2, a member of the Myozenin family, functions as an intracellular binding protein, facilitating the linkage of Z-line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, and LDB3/ZASP, thereby contributing to the localization of calcineurin signaling within the sarcomere. This protein is pivotal in modulating calcineurin signaling, suggesting its involvement in the intricate regulatory mechanisms of muscle function. Additionally, MYOZ2 may play a crucial role in myofibrillogenesis. Through its C-terminus, MYOZ2 interacts with spectrin repeats 3 and 4 of ACTN2, and it engages in interactions with other proteins, including ACTN1, LDB3, MYOT, and PPP3CA. These interactions highlight the significance of MYOZ2 in mediating molecular connections essential for the structural and signaling integrity of the sarcomere.

Human

E. coli

C-6*His

Q9NPC6 (M1-L264)

51778  [NCBI]

MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL

Approximately 38.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.