1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Virus Neuraminidase
  5. NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His)

NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His)

Cat. No.: HY-P73784
COA Handling Instructions

NA (neuraminidase) proteins play a key role in viral transmission by catalyzing the removal of terminal sialic acid residues from viral and cellular glycoconjugates. NA plays a role in determining host range, limiting replication, and virulence. NA is associated with the development and progression of type 2 diabetes mellitus (T2D). NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by HEK293 , with N-His labeled tag. The total length of NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His) is 434 a.a., with molecular weight of 70-90 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $85 In-stock
50 μg $240 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NA (neuraminidase) proteins play a key role in viral transmission by catalyzing the removal of terminal sialic acid residues from viral and cellular glycoconjugates. NA plays a role in determining host range, limiting replication, and virulence. NA is associated with the development and progression of type 2 diabetes mellitus (T2D). NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by HEK293 , with N-His labeled tag. The total length of NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His) is 434 a.a., with molecular weight of 70-90 kDa.

Background

The NA (Neuraminidase) protein plays a pivotal role in viral propagation by catalyzing the removal of terminal sialic acid residues from both viral and cellular glycoconjugates. Specifically, during virus budding, NA cleaves off terminal sialic acids from the glycosylated hemagglutinin (HA), facilitating the release of viral particles and enabling efficient virus spread through the circulation. By preventing self-aggregation and ensuring the removal of sialic acids from the cell surface, NA allows the progeny virus to disseminate efficiently from cell to cell, thereby avoiding limitations to a single round of replication. Described as a receptor-destroying enzyme, NA cleaves terminal sialic acids from cellular receptors, potentially facilitating viral invasion of the upper airways by targeting sialic acid moieties on airway epithelial cell mucin. Its association with lipid rafts during intracellular transport, and its potential raft-independent effect on budding, highlight the multifaceted role of NA in determining host range restriction, replication, and virulence. Moreover, the sialidase activity in late endosome/lysosome traffic appears to enhance virus replication. NA is associated with the development and progression of type 2 diabetes mellitus (T2D)[1][2][3][4].

Species

Virus

Source

HEK293

Tag

N-His

Accession

AYV62750 (H36-K469)

Gene ID

/

Molecular Construction
N-term
His
H1N1 NA (H36-K469)
Accession # AYV62750
C-term
Synonyms
NA; Neuraminidase; NA/Neuraminidase Protein, H1N1 (A/Sw/Bulnes/VN1401-P6SP/2018, HEK293, His)
AA Sequence

HSIQLGSQNYTKTCTQSVITYENNTWVNQTYVNISNTNLAVGQSVVSAKLAGNSSLCPVSGWAIYSKDNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDQHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECVCVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRKGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTVWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK

Molecular Weight

70-90 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NA/Neuraminidase Protein, H1N1 (AYV62750, HEK293, His)
Cat. No.:
HY-P73784
Quantity:
MCE Japan Authorized Agent: