NA/Neuraminidase Protein, H1N1 (P03468, HEK293)

The NA/Neuraminidase Protein is an influenza virus surface enzyme that cleaves sialic acid residues. Inhibiting NA/Neuraminidase Protein is crucial for antiviral drugs. Targeting NA/Neuraminidase Protein can help prevent viral release, reduce viral spread. NA/Neuraminidase Protein, H1N1 (P03468, HEK293) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by HEK293 , with tag free. This product is an active extract, not a recombinant NA protein. It originates from cell lysates collected after expressing a DNA sequence encoding the Influenza A virus neuraminidase.

The NA/Neuraminidase Protein is responsible for catalyzing the removal of terminal sialic acid residues from viral and cellular glycoconjugates. It plays a crucial role in virus release by cleaving off the terminal sialic acids on the glycosylated HA during virus budding, facilitating virus release and aiding in virus spread through the circulation by further removing sialic acids from the cell surface. These cleavages prevent self-aggregation and ensure efficient spread of the progeny virus from cell to cell, allowing for multiple rounds of replication. Referred to as a receptor-destroying enzyme, it cleaves terminal sialic acid from cellular receptors, potentially facilitating viral invasion of the upper airways by cleaving the sialic acid moieties on the mucin of airway epithelial cells. It is likely involved in the budding process through its association with lipid rafts during intracellular transport and may also have a raft-association independent effect on budding. Furthermore, it plays a role in determining host range restriction on replication and virulence, and its sialidase activity in late endosome/lysosome traffic appears to enhance virus replication.

Measured by its ability to cleave a fluorogenic substrate, 2’-(4-Methylumbelliferyl)-α-D-N-acetylneuraminic acid. One unit is defined as the amount of enzyme required to cleave 1 nmole of 2'-(4-Methylumbelliferyl)-α-D-N-acetylneuraminic acid per minute at pH 7.5 at 37℃.

Virus

HEK293

Tag Free

P03468.2 (M1-K454)

956530  [NCBI]

Full Length

MNPNQKIITIGSICLVVGLISLILQIGNIISIWISHSIQTGSQNHTGICNQNIITYKNSTWVKDTTSVILTGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPVGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITETIKSWRKKILRTQESECACVNGSCFTIMTDGPSDGLASYKIFKIEKGKVTKSIELNAPNSHYEECSCYPDTGKVMCVCRDNWHGSNRPWVSFDQNLDYQIGYICSGVFGDNPRPEDGTGSCGPVYVDGANGVKGFSYRYGNGVWIGRTKSHSSRHGFEMIWDPNGWTETDSKFSVRQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPKEKTIWTSASSISFCGVNSDTVDWSWPDGAELPFSIDK

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 1% Triton X-100 (protease inhibitor included), pH 7.4, 10% Trehalose.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.