1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Virus Neuraminidase
  5. NA/Neuraminidase Protein, H1N1 (P03469, HEK293, His)

NA/Neuraminidase Protein, H1N1 (P03469, HEK293, His)

Cat. No.: HY-P73776
Handling Instructions Technical Support

NA/Neuraminidase Protein, an enzyme found on the surface of influenza viruses, is responsible for the cleavage of sialic acid residues. Inhibition of NA/Neuraminidase Protein is a key target for antiviral drugs. Targeting NA/Neuraminidase Protein may provide potential therapeutic interventions by preventing viral release, reducing viral spread. NA/Neuraminidase Protein, H1N1 (P03469, HEK293, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NA/Neuraminidase Protein, an enzyme found on the surface of influenza viruses, is responsible for the cleavage of sialic acid residues. Inhibition of NA/Neuraminidase Protein is a key target for antiviral drugs. Targeting NA/Neuraminidase Protein may provide potential therapeutic interventions by preventing viral release, reducing viral spread. NA/Neuraminidase Protein, H1N1 (P03469, HEK293, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by HEK293 , with N-His labeled tag.

Background

The NA/Neuraminidase protein acts as a catalyst in removing sialic acid residues from viral and cellular glycoconjugates. It plays a crucial role in virus budding by cleaving off terminal sialic acids on the glycosylated HA, aiding in the release of the virus. Additionally, it facilitates virus spread by further removing sialic acids from the cell surface, preventing self-aggregation and ensuring efficient spread from cell to cell. This protein is referred to as a receptor-destroying enzyme as it cleaves terminal sialic acids from cellular receptors. It may also contribute to viral invasion of the upper airways by cleaving sialic acid moieties on the mucin of airway epithelial cells. NA is associated with lipid rafts during intracellular transport, potentially aiding in the budding process, and may have raft-association independent effects as well. It is involved in determining host range restriction on replication and virulence, and its sialidase activity in late endosome/lysosome traffic appears to enhance virus replication.

Species

Virus

Source

HEK293

Tag

N-His

Accession

P03469 (H36-K470)

Gene ID

/

Molecular Construction
N-term
His
H1N1 NA (H36-K470)
Accession # P03469
C-term
Protein Length

Partial

Synonyms
NA; Neuraminidase; NA/Neuraminidase Protein, H1N1 (A/USSR/90/1977, HEK293, His)
AA Sequence

HSIQTGSQNHTGICNQRIITYENSTWVNQTYVNISNTNVVAGKDTTSMTLAGNSSLCPIRGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPYRALMSCPIGEAPSPYNSRFESVAWSASACHDGMGWLTIGISGPDDGAVAVLKYNGIITETIKSWRKQILRTQESECVCVNGSCFTIMTDGPSDGPASYRIFKIEKGKITKSIELDAPNSHYEECSCYPDTGTVMCVCRDNWHGSNRPWVSFNQNLDYQIGYICSGVFGDNPRPKDGKGSCDPVNVDGADGVKGFSYRYGNGVWIGRTKSNSSRKGFEMIWDPNGWTDTDSNFLVKQDVVAMTDWSGYSGSFVQHPELTGLDCMRPCFWVELIRGRPREKTTIWTSGSSISFCGVNSDTVNWSWPDGAELPFTIDK

Predicted Molecular Mass
50.4 kDa
Molecular Weight

Approximately 76.6 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NA/Neuraminidase Protein, H1N1 (P03469, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NA/Neuraminidase Protein, H1N1 (P03469, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NA/Neuraminidase Protein, H1N1 (P03469, HEK293, His)
Cat. No.:
HY-P73776
Quantity:
MCE Japan Authorized Agent: