1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Virus Neuraminidase
  5. NA/Neuraminidase Protein, H3N2 (ACN50232, HEK293)

NA/Neuraminidase Protein, H3N2 (ACN50232, HEK293)

Art. -Nr.: HY-P73771
Handling Instructions Technical Support

NA/Neuraminidase Protein is a receptor-destroying enzyme that cleaves terminal sialic acids from cellular receptors, potentially facilitating viral invasion of the upper airways by targeting sialic acid moieties on airway epithelial cell mucin. NA plays a pivotal role in viral propagation by catalyzing the removal of terminal sialic acid residues from both viral and cellular glycoconjugates. Moreover, the sialidase activity in late endosome/lysosome traffic appears to enhance virus replication. NA/Neuraminidase Protein, H3N2 (ACN50232, HEK293) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by HEK293 , with tag free. It originates from cell lysates collected after expressing a DNA sequence encoding the Influenza A virus neuraminidase.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Verfügbarkeit
50 μg   Angebot einholen  
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

  • Verweise

Beschreibung

NA/Neuraminidase Protein is a receptor-destroying enzyme that cleaves terminal sialic acids from cellular receptors, potentially facilitating viral invasion of the upper airways by targeting sialic acid moieties on airway epithelial cell mucin. NA plays a pivotal role in viral propagation by catalyzing the removal of terminal sialic acid residues from both viral and cellular glycoconjugates. Moreover, the sialidase activity in late endosome/lysosome traffic appears to enhance virus replication. NA/Neuraminidase Protein, H3N2 (ACN50232, HEK293) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by HEK293 , with tag free. It originates from cell lysates collected after expressing a DNA sequence encoding the Influenza A virus neuraminidase.

Background

Neuraminidase (NA) plays a pivotal role in viral propagation by catalyzing the removal of terminal sialic acid residues from both viral and cellular glycoconjugates. Specifically, during virus budding, NA cleaves off terminal sialic acids from the glycosylated hemagglutinin (HA), facilitating the release of viral particles and enabling efficient virus spread through the circulation. By preventing self-aggregation and ensuring the removal of sialic acids from the cell surface, NA allows the progeny virus to disseminate efficiently from cell to cell, thereby avoiding limitations to a single round of replication. Described as a receptor-destroying enzyme, NA cleaves terminal sialic acids from cellular receptors, potentially facilitating viral invasion of the upper airways by targeting sialic acid moieties on airway epithelial cell mucin. Its association with lipid rafts during intracellular transport, and its potential raft-independent effect on budding, highlight the multifaceted role of NA in determining host range restriction, replication, and virulence. Moreover, the sialidase activity in late endosome/lysosome traffic appears to enhance virus replication[1][2][3].

Species

Virus

Source

HEK293

Tag

Tag Free

Accession

ACN50232 (H36-P459)

Gene ID

/

Molecular Construction
N-term
H3N2 NA (H36-P459)
Accession # ACN50232
C-term
Protein Length

Partial

Synonyms
NA; Neuraminidase; NA/Neuraminidase Protein, H3N2 (HEK293)
AA Sequence

HFKQYEFNSPPNNQVMLCEPTIIERNITEIVYLTNTTIEKEICPKLAEYRNWSKPQCDITGFAPFSKDNSIRLSAGGDIWVTREPYVSCDPDKCYQFALGQGTTLNNVHSNDTVHDRTPYRTLLMNELGVPFHLGTKQVCIAWSSSSCHDGKAWLHVCVTGDDKNATASFIYNGRLVDSIVSWSKEILRTQESECVCINGTCTVVMTDGSASGKADTKILFIEEGKIVHTSTLSGSAQHVEECSCYPRYPGVRCVCRDNWKGSNRPIVDINIKDYSIVSSYVCSGLVGDTPRKNDSSSSSHCLDPNNEEGGHGVKGWAFDDGNDVWMGRTISEKLRSGYETFKVIEGWSNPNSKLQINRQVIVDRGNRSGYSGIFSVEGKSCINRCFYVELIRGRKEETEVLWTSNSIVVFCGTSGTYGTGSWP

Dokumentation
Verweise

NA/Neuraminidase Protein, H3N2 (ACN50232, HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

NA/Neuraminidase Protein, H3N2 (ACN50232, HEK293)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
NA/Neuraminidase Protein, H3N2 (ACN50232, HEK293)
Art. -Nr.:
HY-P73771
Menge:
MCE Japan Authorized Agent: