1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Virus Neuraminidase
  5. NA/Neuraminidase Protein, H3N2 (AVG71505, sf9, His)

NA/Neuraminidase Protein, H3N2 (AVG71505, sf9, His)

Cat. No.: HY-P73765
Handling Instructions Technical Support

NA/Neuraminidase Protein is a receptor-destroying enzyme that cleaves terminal sialic acids from cellular receptors, potentially facilitating viral invasion of the upper airways by targeting sialic acid moieties on airway epithelial cell mucin. NA plays a pivotal role in viral propagation by catalyzing the removal of terminal sialic acid residues from both viral and cellular glycoconjugates. Moreover, the sialidase activity in late endosome/lysosome traffic appears to enhance virus replication. NA/Neuraminidase Protein, H3N2 (AVG71505, sf9, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by Sf9 insect cells , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

NA/Neuraminidase Protein is a receptor-destroying enzyme that cleaves terminal sialic acids from cellular receptors, potentially facilitating viral invasion of the upper airways by targeting sialic acid moieties on airway epithelial cell mucin. NA plays a pivotal role in viral propagation by catalyzing the removal of terminal sialic acid residues from both viral and cellular glycoconjugates. Moreover, the sialidase activity in late endosome/lysosome traffic appears to enhance virus replication. NA/Neuraminidase Protein, H3N2 (AVG71505, sf9, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Neuraminidase (NA) plays a pivotal role in viral propagation by catalyzing the removal of terminal sialic acid residues from both viral and cellular glycoconjugates. Specifically, during virus budding, NA cleaves off terminal sialic acids from the glycosylated hemagglutinin (HA), facilitating the release of viral particles and enabling efficient virus spread through the circulation. By preventing self-aggregation and ensuring the removal of sialic acids from the cell surface, NA allows the progeny virus to disseminate efficiently from cell to cell, thereby avoiding limitations to a single round of replication. Described as a receptor-destroying enzyme, NA cleaves terminal sialic acids from cellular receptors, potentially facilitating viral invasion of the upper airways by targeting sialic acid moieties on airway epithelial cell mucin. Its association with lipid rafts during intracellular transport, and its potential raft-independent effect on budding, highlight the multifaceted role of NA in determining host range restriction, replication, and virulence. Moreover, the sialidase activity in late endosome/lysosome traffic appears to enhance virus replication[1][2][3].

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

AVG71505 (I30-I469)

Gene ID

/

Molecular Construction
N-term
H3N2 NA (I30-I469)
Accession # AVG71505
His
C-term
Protein Length

Partial

Synonyms
NA; Neuraminidase; NA/Neuraminidase Protein, H3N2 (A/Kansas/14/2017, sf9, His)
AA Sequence

ITTVTLHFKQYEFNSPPNNQVMLCEPTIIERNITEIVYLTNTTIEREICPKPAEYRNWSKPQCGITGFAPFSKDNSIRLSAGGDIWVTREPYVSCDPDKCYQFALGQGTTINNVHSNNTARDRTPHRTLLMNELGVPFHLGTKQVCIAWSSSSCHDGKAWLHVCITGDDKNATASFIYNGRLVDSVVSWSKDILRTQESECVCINGTCTVVMTDGNATGKADTKILFIEEGKIVHTSKLSGSAQHVEECSCYPRYPGVRCVCRDNWKGSNRPIVDINIKDHSIVSSYVCSGLVGDTPRKTDSSSSSHCLNPNNEKGGHGVKGWAFDDGNDVWMGRTINETSRLGYETFKVVEGWSNPKSKLQINRQVIVDRGDRSGYSGIFSVEGKSCINRCFYVELIRGRKEETEVLWTSNSIVVFCGTSGTYGTGSWPDGADLNLMHI

Predicted Molecular Mass
54.6 kDa
분자량

Approximately 56.5 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

NA/Neuraminidase Protein, H3N2 (AVG71505, sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

NA/Neuraminidase Protein, H3N2 (AVG71505, sf9, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
NA/Neuraminidase Protein, H3N2 (AVG71505, sf9, His)
Cat. No.:
HY-P73765
수량:
MCE Japan Authorized Agent: