1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Virus Neuraminidase
  5. NA/Neuraminidase Protein, H5N1 (ABU94738, sf9, His)

NA/Neuraminidase Protein, H5N1 (ABU94738, sf9, His)

Cat. No.: HY-P73758
Handling Instructions Technical Support

Neuraminidase (NA) is described as a receptor-destroying enzyme because it cleaves a terminal sialic acid from the cellular receptors. Whereby, NA facilitates viral invasion of the upper airways, facilitates virus release during virus budding, prevents self-aggregation and ensures the efficient spread of the progeny virus from cell to cell, and also plays a role in the determination of host range restriction on replication and virulence. NA/Neuraminidase Protein, H5N1 (ABU94738, sf9, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neuraminidase (NA) is described as a receptor-destroying enzyme because it cleaves a terminal sialic acid from the cellular receptors. Whereby, NA facilitates viral invasion of the upper airways, facilitates virus release during virus budding, prevents self-aggregation and ensures the efficient spread of the progeny virus from cell to cell, and also plays a role in the determination of host range restriction on replication and virulence. NA/Neuraminidase Protein, H5N1 (ABU94738, sf9, His) is the recombinant Virus-derived NA/Neuraminidase protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Neuraminidase (NA) is described as a receptor-destroying enzyme because it cleaves a terminal sialic acid from the cellular receptors. NA may facilitate viral invasion of the upper airways by cleaving the sialic acid moities on the mucin of the airway epithelial cells. NA catalyzes the removal of terminal sialic acid residues from viral and cellular glycoconjugates, cleaves off the terminal sialic acids on the glycosylated HA during virus budding to facilitate virus release and additionally helps virus spread through the circulation by further removing sialic acids from the cell surface. These cleavages prevent self-aggregation and ensure the efficient spread of the progeny virus from cell to cell or the infection would be limited to one round of replication. NA also plays a role in the determination of host range restriction on replication and virulence[1][2].

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

ABU94738 (H36-K449)

Gene ID

/

Molecular Construction
N-term
H5N1 NA (H36-K449)
Accession # ABU94738
His
C-term
Protein Length

Partial

Synonyms
NA; Neuraminidase; NA/Neuraminidase Protein, H5N1 (A/Anhui/1/2005, sf9, His)
AA Sequence

HSIQTGNQHQAEPIRNANFLTENAVASVTLAGNSSLCPVRGWAVHSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFKMEKGKVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSPNGAYGIKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSNFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVSWSWPDGAELPFTIDK

Predicted Molecular Mass
51.1 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NA/Neuraminidase Protein, H5N1 (ABU94738, sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NA/Neuraminidase Protein, H5N1 (ABU94738, sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NA/Neuraminidase Protein, H5N1 (ABU94738, sf9, His)
Cat. No.:
HY-P73758
Quantity:
MCE Japan Authorized Agent: