1. Recombinant Proteins
  2. Others
  3. NAA10/ARD1 Protein, Human (sf9, His-GST)

The NAA10/ARD1 protein is the catalytic subunit of the N-terminal acetyltransferase complex and has alpha acetyltransferase activity. NAA10/ARD1 affects vascular, hematopoietic, and neuronal growth and development. NAA10/ARD1 inhibits tumor cell migration, inhibits mTOR activity and cancer development. NAA10/ARD1 Protein, Human (sf9, His-GST) is the recombinant human-derived NAA10/ARD1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NAA10/ARD1 protein is the catalytic subunit of the N-terminal acetyltransferase complex and has alpha acetyltransferase activity. NAA10/ARD1 affects vascular, hematopoietic, and neuronal growth and development. NAA10/ARD1 inhibits tumor cell migration, inhibits mTOR activity and cancer development. NAA10/ARD1 Protein, Human (sf9, His-GST) is the recombinant human-derived NAA10/ARD1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

NAA10, the catalytic subunit of N-terminal acetyltransferase complexes, exhibits alpha (N-terminal) acetyltransferase activity, playing a crucial role in acetylating amino termini lacking initiator methionine. This activity holds significance in processes related to vascular, hematopoietic, and neuronal growth and development. In conjunction with NAA15, NAA10 displays epsilon (internal) acetyltransferase activity towards HIF1A, leading to its degradation and impacting cellular responses. Notably, NAA10 has diverse roles, repressing MYLK kinase activity through acetylation to inhibit tumor cell migration and stabilizing TSC2, thereby suppressing mTOR activity and impeding cancer development. Furthermore, NAA10 acetylates HSPA1A and HSPA1B at 'Lys-77,' enhancing their chaperone activity and promoting preferential binding to co-chaperone HOPX. Additional substrates include HIST1H4A, indicating a broad impact on cellular processes. Intriguingly, NAA10 acts as a negative regulator of sister chromatid cohesion during mitosis, underscoring its multifunctional role in cellular homeostasis.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P41227 (M1-S235)

Gene ID
Molecular Construction
N-term
His-GST
NAA10 (M1-S235)
Accession # P41227
C-term
Protein Length

Full Length

Synonyms
N-alpha-acetyltransferase 10; hARD1; NatA catalytic subunit Naa10; ARD1; ARD1A; TE2
AA Sequence

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS

Predicted Molecular Mass
54 kDa
Molecular Weight

Approximately 49 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NAA10/ARD1 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NAA10/ARD1 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NAA10/ARD1 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P77097
Quantity:
MCE Japan Authorized Agent: