Neuraminidase Protein, M.viridifaciens (His)

Neuraminidase is a subtype of sialidase associated with the pathogenic potential of microbial infections. As an enzyme, neuraminidase plays a crucial role in catalyzing the removal of terminal sialic acid residues from glycoproteins and glycolipids. Neuraminidase Protein, M.viridifaciens (His) is the recombinant Neuraminidase protein, expressed by E. coli , with N-His labeled tag.

Neuraminidase is a subtype of sialidases that has been linked to potential pathogenicity in microbial infections. As an enzyme, neuraminidase plays a crucial role in catalyzing the removal of terminal sialic acid residues from glycoproteins and glycolipids. This activity allows the virus or bacteria to facilitate its spread within the host by promoting the release of newly formed viral particles or by enhancing its ability to adhere to and invade host cells. Neuraminidase is considered a critical virulence factor in various pathogens and is targeted by antiviral drugs to inhibit its enzymatic activity and hinder the progression of infection. Understanding the functions and mechanisms of neuraminidase is crucial for developing effective strategies to combat microbial infections.

Others

E. coli

N-His

BAA00852 (P42-G403)

/

Partial

PVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGTDPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQYTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRKVAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIRMSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG

Approximately 39.7 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.