1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Virus Neuraminidase
  5. Neuraminidase Protein, M.viridifaciens (His)

Neuraminidase is a subtype of sialidase associated with the pathogenic potential of microbial infections. As an enzyme, neuraminidase plays a crucial role in catalyzing the removal of terminal sialic acid residues from glycoproteins and glycolipids. Neuraminidase Protein, M.viridifaciens (His) is the recombinant Neuraminidase protein, expressed by E. coli , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Neuraminidase is a subtype of sialidase associated with the pathogenic potential of microbial infections. As an enzyme, neuraminidase plays a crucial role in catalyzing the removal of terminal sialic acid residues from glycoproteins and glycolipids. Neuraminidase Protein, M.viridifaciens (His) is the recombinant Neuraminidase protein, expressed by E. coli , with N-His labeled tag.

Background

Neuraminidase is a subtype of sialidases that has been linked to potential pathogenicity in microbial infections. As an enzyme, neuraminidase plays a crucial role in catalyzing the removal of terminal sialic acid residues from glycoproteins and glycolipids. This activity allows the virus or bacteria to facilitate its spread within the host by promoting the release of newly formed viral particles or by enhancing its ability to adhere to and invade host cells. Neuraminidase is considered a critical virulence factor in various pathogens and is targeted by antiviral drugs to inhibit its enzymatic activity and hinder the progression of infection. Understanding the functions and mechanisms of neuraminidase is crucial for developing effective strategies to combat microbial infections.

Species

Others

Source

E. coli

Tag

N-His

Accession

BAA00852 (P42-G403)

Gene ID

/

Molecular Construction
N-term
His
Neuraminidase (P42-G403)
Accession # BAA00852
C-term
Protein Length

Partial

Synonyms
Sialidase; Neuraminidase; nedA
AA Sequence

PVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQRRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGTDPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQYTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRKVAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIRMSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG

Predicted Molecular Mass
39.7 kDa
분자량

Approximately 39.7 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

Neuraminidase Protein, M.viridifaciens (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Neuraminidase Protein, M.viridifaciens (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Neuraminidase Protein, M.viridifaciens (His)
Cat. No.:
HY-P77073
수량:
MCE Japan Authorized Agent: