1. Recombinant Proteins
  2. Others
  3. NFYA Protein, Human

The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.

Background

NFYA protein serves as a vital component of the sequence-specific heterotrimeric transcription factor NF-Y, which specifically recognizes the 5'-CCAAT-3' box motif in the promoters of its target genes. This transcription factor, composed of NF-YA, NF-YB, and NF-YC, functions both as an activator and a repressor, depending on its interacting cofactors. NFYA, in particular, plays a role in positively regulating the transcription of the core clock component BMAL1. The formation of the NF-Y heterotrimer requires the interaction and dimerization of NF-YB and NF-YC, enabling NF-YA association and subsequent DNA binding. NFYA also engages in interactions with SP1, and this interaction is inhibited by glycosylation of SP1. Furthermore, NFYA interacts with ZHX1 and ZHX2, specifically through its N-terminus, as well as with ZFX3. These diverse interactions emphasize the versatile regulatory role of NFYA in the complex orchestration of transcriptional processes.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P23511-2 (M1-S318)

Gene ID
Molecular Construction
N-term
NFYA (M1-S318)
Accession # P23511-2
C-term
Protein Length

Full Length of Isoform-2

Synonyms
Nuclear Transcription Factor Y Subunit Alpha; CAAT Box DNA-Binding Protein Subunit A; Nuclear Transcription Factor Y Subunit A; NF-YA; NFYA
AA Sequence

MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Predicted Molecular Mass
33.9 kDa
Peso molecular

Approximately 37 kDa,based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Glycine-HCl, 15% trehalose, 2 mM EDTA, 0.05% Tween 80, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US;may vary elsewhere.

Documentación

NFYA Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

NFYA Protein, Human

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
NFYA Protein, Human
Cat. No.:
HY-P71135
Cantidad:
MCE Japan Authorized Agent: