NFYA Protein, Human
Based on 1 Customer Validation
The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.
NFYA protein serves as a vital component of the sequence-specific heterotrimeric transcription factor NF-Y, which specifically recognizes the 5'-CCAAT-3' box motif in the promoters of its target genes. This transcription factor, composed of NF-YA, NF-YB, and NF-YC, functions both as an activator and a repressor, depending on its interacting cofactors. NFYA, in particular, plays a role in positively regulating the transcription of the core clock component BMAL1. The formation of the NF-Y heterotrimer requires the interaction and dimerization of NF-YB and NF-YC, enabling NF-YA association and subsequent DNA binding. NFYA also engages in interactions with SP1, and this interaction is inhibited by glycosylation of SP1. Furthermore, NFYA interacts with ZHX1 and ZHX2, specifically through its N-terminus, as well as with ZFX3. These diverse interactions emphasize the versatile regulatory role of NFYA in the complex orchestration of transcriptional processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P23511-2 (M1-S318)
-
Molecular Construction
-
N-term
-
NFYA (M1-S318)
Accession # P23511-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
Nuclear Transcription Factor Y Subunit Alpha; CAAT Box DNA-Binding Protein Subunit A; Nuclear Transcription Factor Y Subunit A; NF-YA; NFYA
-
AA Sequence
MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
-
Predicted Molecular Mass
33.9 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM Glycine-HCl, 15% trehalose, 2 mM EDTA, 0.05% Tween 80, pH 2.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)