NHP2 Protein, Human (His)

The NHP2 protein is essential for ribosome biogenesis and telomere maintenance and is a key component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. In this complex, NHP2 catalyzes pseudouridylation of rRNA by isomerizing uridine, thereby stabilizing the rRNA conformation with up to 100 pseudouridine residues. NHP2 Protein, Human (His) is the recombinant human-derived NHP2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NHP2 Protein, Human (His) is 153 a.a., with molecular weight of ~22.0 kDa.

NHP2 plays an essential role in cellular processes by participating in ribosome biogenesis and telomere maintenance. As a component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, NHP2 contributes to the catalysis of pseudouridylation in rRNA, a modification critical for stabilizing rRNA conformation. Additionally, NHP2 is implicated in the correct processing and intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme. The H/ACA snoRNP complex, comprising NHP2 along with other subunits, including GAR1, NOP10, and DKC1, forms a stable core involved in recognizing specific RNA substrates. During assembly, NHP2 interacts with NAF1, and the complex binds box H/ACA snoRNAs or TERC, with GAR1 and NHP2 mediating specific interactions. NHP2 is also associated with NOLC1/NOPP140. Moreover, NHP2 contributes to the telomerase holoenzyme complex, collaborating with TERT, WRAP53/TCAB1, DKC1, NOP10, and GAR1, in concert with other components such as TEP1, SMG6/EST1A, and POT1. These interactions underline the multifaceted roles of NHP2 in fundamental cellular functions.

Human

E. coli

N-6*His

Q9NX24 (M1-L153)

55651  [NCBI]

MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL

Approximately 22.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.