NHP2 Protein, Human (His)
The NHP2 protein is essential for ribosome biogenesis and telomere maintenance and is a key component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. In this complex, NHP2 catalyzes pseudouridylation of rRNA by isomerizing uridine, thereby stabilizing the rRNA conformation with up to 100 pseudouridine residues. NHP2 Protein, Human (His) is the recombinant human-derived NHP2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The NHP2 protein is essential for ribosome biogenesis and telomere maintenance and is a key component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex. In this complex, NHP2 catalyzes pseudouridylation of rRNA by isomerizing uridine, thereby stabilizing the rRNA conformation with up to 100 pseudouridine residues. NHP2 Protein, Human (His) is the recombinant human-derived NHP2 protein, expressed by E. coli , with N-6*His labeled tag.
NHP2 plays an essential role in cellular processes by participating in ribosome biogenesis and telomere maintenance. As a component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, NHP2 contributes to the catalysis of pseudouridylation in rRNA, a modification critical for stabilizing rRNA conformation. Additionally, NHP2 is implicated in the correct processing and intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme. The H/ACA snoRNP complex, comprising NHP2 along with other subunits, including GAR1, NOP10, and DKC1, forms a stable core involved in recognizing specific RNA substrates. During assembly, NHP2 interacts with NAF1, and the complex binds box H/ACA snoRNAs or TERC, with GAR1 and NHP2 mediating specific interactions. NHP2 is also associated with NOLC1/NOPP140. Moreover, NHP2 contributes to the telomerase holoenzyme complex, collaborating with TERT, WRAP53/TCAB1, DKC1, NOP10, and GAR1, in concert with other components such as TEP1, SMG6/EST1A, and POT1. These interactions underline the multifaceted roles of NHP2 in fundamental cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NX24 (M1-L153)
-
Molecular Construction
-
N-term
-
6*His
-
NHP2 (M1-L153)
Accession # Q9NX24 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NHP2; NHP2 Ribonucleoprotein Homolog (Yeast); Prev. NOLA2; NHP2 Ribonucleoprotein Homolog; H/ACA Ribonucleoprotein Complex Subunit 2; NHP2-Like Protein; Nucleolar Protein Family A, Member 2 (H/ACA Small Nucleolar RNPs); NHP2P; SnoRNP Protein NHP2; DKCB2;
-
AA Sequence
MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
-
Predicted Molecular Mass
19.3 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
