NIP7 Protein, Human (His)
NIP7 is essential for precise processing of 34S pre-rRNA and assembly of 60S ribosomal subunits. As a monomer, NIP7 interacts with preribosomal complexes, may bind to RNA, and binds to key protein partners, including NOL8, SBDS, and FTSJ3. NIP7 Protein, Human (His) is the recombinant human-derived NIP7 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
NIP7 is essential for precise processing of 34S pre-rRNA and assembly of 60S ribosomal subunits. As a monomer, NIP7 interacts with preribosomal complexes, may bind to RNA, and binds to key protein partners, including NOL8, SBDS, and FTSJ3. NIP7 Protein, Human (His) is the recombinant human-derived NIP7 protein, expressed by E. coli , with N-6*His labeled tag.
Background
NIP7 plays an essential role in ensuring the accurate processing of 34S pre-rRNA and the assembly of the 60S ribosome subunit. Operating as a monomer, NIP7 interacts with the pre-ribosome complex, potentially binding to RNA and engaging in crucial interactions with various protein partners such as NOL8, SBDS, and FTSJ3. These interactions contribute to the intricate network of molecular events involved in the maturation and assembly of ribosomal subunits, highlighting the significance of NIP7 in the complex machinery of ribosome biogenesis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y221-1 (M1-T180)
-
Molecular Construction
-
N-term
-
6*His
-
NIP7 (M1-T180)
Accession # Q9Y221-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
NIP7; 60S Ribosome Subunit Biogenesis Protein NIP7 Homolog; Nucleolar Pre-RRNA Processing Protein NIP7; FLJ10296; KD93; NIP7, Nucleolar Pre-RRNA Processing Protein; HSPC031; Nuclear Import 7 Homolog (S. Cerevisiae); CGI-37; Nuclear Import 7 Homolog
-
AA Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
-
Predicted Molecular Mass
22.6 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)