NIP7 Protein, Human (His)

NIP7 is essential for precise processing of 34S pre-rRNA and assembly of 60S ribosomal subunits. As a monomer, NIP7 interacts with preribosomal complexes, may bind to RNA, and binds to key protein partners, including NOL8, SBDS, and FTSJ3. NIP7 Protein, Human (His) is the recombinant human-derived NIP7 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NIP7 Protein, Human (His) is 180 a.a., with molecular weight of ~20.0 kDa.

NIP7 plays an essential role in ensuring the accurate processing of 34S pre-rRNA and the assembly of the 60S ribosome subunit. Operating as a monomer, NIP7 interacts with the pre-ribosome complex, potentially binding to RNA and engaging in crucial interactions with various protein partners such as NOL8, SBDS, and FTSJ3. These interactions contribute to the intricate network of molecular events involved in the maturation and assembly of ribosomal subunits, highlighting the significance of NIP7 in the complex machinery of ribosome biogenesis.

Human

E. coli

N-6*His

Q9Y221 (M1-T180)

51388  [NCBI]

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Approximately 20.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.