1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. NKG2A/CD159a
  5. NKG2A Protein, Cynomolgus/Rhesus macaque (HEK293, His)

NKG2A Protein, Cynomolgus/Rhesus macaque (HEK293, His)

Cat. No.: HY-P78576
Instrucciones de manejo Technical Support

NKG2A Protein, Cynomolgus/Rhesus macaque (HEK293, His) is the recombinant cynomolgus, Rhesus Macaque-derived NKG2A protein, expressed by HEK293, with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

NKG2A Protein, Cynomolgus/Rhesus macaque (HEK293, His) is the recombinant cynomolgus, Rhesus Macaque-derived NKG2A protein, expressed by HEK293, with N-His labeled tag.

Background

NKG2A Protein, an immune inhibitory receptor crucial for self-nonself discrimination, forms a complex with KLRD1 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides from the signal sequence of classical MHC class Ia molecules. This recognition allows cytotoxic cells to monitor MHC class I expression in healthy cells and promotes self-tolerance. Upon binding to HLA-E-peptide complexes, NKG2A transmits intracellular signals through two immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHP-1 and INPPL1/SHP-2 tyrosine phosphatases to oppose signals from activating receptors. As a key inhibitory receptor on natural killer (NK) cells, NKG2A regulates their activation and effector functions, countering T cell receptor signaling on a subset of memory/effector CD8-positive T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, NKG2A acts as an immune inhibitory checkpoint, contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a phenomenon known as cell exhaustion. Notably, during viral infection, NKG2A recognizes HLA-E in complex with human cytomegalovirus-derived peptides, inhibiting NK cell cytotoxicity and facilitating viral immune escape.

Actividad biológica

Immobilized Human CD94 at 2 μg/mL (100 μL/well) on the plate can bind Biotinylated Cynomolgus NKG2A. The ED50 for this effect is 4.795 μg/mL.

  • Immobilized Human CD94 at 2 μg/mL (100 μL/well) on the plate can bind Biotinylated Cynomolgus NKG2A. The ED50 for this effect is 4.795 μg/mL.
Species

Cynomolgus; Rhesus Macaque

Source

HEK293

Tag

N-His

Accession

Q68VD2/Q9MZJ2 (P94-L233)

Gene ID

102121106

Molecular Construction
N-term
His
NKG2A (P94-L233)
Accession # Q68VD2/Q9MZJ2
C-term
Protein Length

Cytoplasmic Domain

Synonyms
NKG2A; CD159a; KLRC1; NK cell receptor A
AA Sequence

PSTLTQKHNNSSLNTRTQKACHCGHCPEEWITYSNSCYYIGKEKRTWAESLLACTLKNSSLLSIDNEEEMKFLTAISPSTWTGVFRDSSQHPWVTINGLTFKHEIKDSDNAEHNCAMLHARGLKSDRCGSSKIYHCKHKL

Peso molecular

23-45 kDa

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

NKG2A Protein, Cynomolgus/Rhesus macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

NKG2A Protein, Cynomolgus/Rhesus macaque (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
NKG2A Protein, Cynomolgus/Rhesus macaque (HEK293, His)
Cat. No.:
HY-P78576
Cantidad:
MCE Japan Authorized Agent: