1. Recombinant Proteins
  2. Others
  3. NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution)

NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution)

Cat. No.: HY-P703821
Handling Instructions Technical Support

NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function. NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function[1][2][3]. NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293, with N-His labeled tag.

Background

NKp46 is a ~46 kDa type 1 transmembrane glycoprotein characterized by a 30 a.a. intracellular tail, 20 a.a. transmembrane domain, and two extracellular Ig-like domains that are contacted through a 25 a.a short peptide. NKp46 is a novel triggering receptor that is involved in natural cytotoxicity[1].
NKp46 is uniquely expressed on all NK cell subsets and has been suggested as a possible target for NK cell ablation and as a pan NK cell marker. Distinct among the NCRs, NKp46 (NCR1) is evolutionary conserved between mice and humans. knock-down of NKp46 in primary human NK cells decreased recruitment of F-actin to the synapse[1].
NKp46 contributes to clearance of Streptococcus pneumoniae by interacting with infected alveolar macrophages. Targeting of NK cells using an NKp46 antibody can attenuate type 1 diabetes progression in mice. NKp46 also regulates graft-versus-host disease and allergic response. Following the initiation of an NK-target cell interaction, NKp46 clusters at the cell membrane, specifically at the immune synapse. At the immune synapse, NKp46 mediates cytoskeletal rearrangement and cellular polarization[1].
Cross-linking of NKp46 led to a strong NK cell activation resulting in induction of Ca2+ mobilization, cytotoxicity and lymphokine release[2].
The natural cytotoxicity receptor (NCR) family that includes NKp30, NKp44, and NKp46 is the biggest family of activating human NK-cell receptors. NKp46 is the only NCR member that has a mouse orthologue, named Ncr1. The first ligand identified for NKp46/NCR1 receptors is the hemagglutinin (HA) protein of influenza virus[3].

Species

Human

Source

HEK293

Tag

N-8*His

Accession

AAH64806 (Q22-N254)

Gene ID

9437

Protein Length

Partial

Conjugation

Biotin

Synonyms
CD335; Ly94; NCR1; NKp46; MAR-1; NKP46FLJ99094
AA Sequence

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQN

Predicted Molecular Mass
27.5 kDa
Molecular Weight

Approximately 38-48 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution)
Cat. No.:
HY-P703821
Quantity:
MCE Japan Authorized Agent: