NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution)

NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function^[1][2][3]. NKp46/NCR1 Protein, Human (Biotinylated, HEK293, His, solution) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293, with N-His labeled tag.

NKp46 is a ~46 kDa type 1 transmembrane glycoprotein characterized by a 30 a.a. intracellular tail, 20 a.a. transmembrane domain, and two extracellular Ig-like domains that are contacted through a 25 a.a short peptide. NKp46 is a novel triggering receptor that is involved in natural cytotoxicity^[1].
NKp46 is uniquely expressed on all NK cell subsets and has been suggested as a possible target for NK cell ablation and as a pan NK cell marker. Distinct among the NCRs, NKp46 (NCR1) is evolutionary conserved between mice and humans. knock-down of NKp46 in primary human NK cells decreased recruitment of F-actin to the synapse^[1].
NKp46 contributes to clearance of Streptococcus pneumoniae by interacting with infected alveolar macrophages. Targeting of NK cells using an NKp46 antibody can attenuate type 1 diabetes progression in mice. NKp46 also regulates graft-versus-host disease and allergic response. Following the initiation of an NK-target cell interaction, NKp46 clusters at the cell membrane, specifically at the immune synapse. At the immune synapse, NKp46 mediates cytoskeletal rearrangement and cellular polarization^[1].
Cross-linking of NKp46 led to a strong NK cell activation resulting in induction of Ca²⁺ mobilization, cytotoxicity and lymphokine release^[2].
The natural cytotoxicity receptor (NCR) family that includes NKp30, NKp44, and NKp46 is the biggest family of activating human NK-cell receptors. NKp46 is the only NCR member that has a mouse orthologue, named Ncr1. The first ligand identified for NKp46/NCR1 receptors is the hemagglutinin (HA) protein of influenza virus^[3].

Human

HEK293

N-8*His

AAH64806 (Q22-N254)

9437

Partial

Biotin

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQN

Approximately 38-48 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Uzi Hadad, et al. NKp46 Clusters at the Immune Synapse and Regulates NK Cell Polarization. Front Immunol. 2015 Sep 25:6:495.  [Content Brief]

  [2]. S Sivori, et al. NKp46 is the major triggering receptor involved in the natural cytotoxicity of fresh or cultured human NK cells. Correlation between surface density of NKp46 and natural cytotoxicity against autologous, allogeneic or xenogeneic target cells. Eur J Immunol. 1999 May;29(5):1656-66.  [Content Brief]

  [3]. Alexander David Barrow, et al. The Natural Cytotoxicity Receptors in Health and Disease. Front Immunol. 2019 May 7:10:909.  [Content Brief]