NKp46/NCR1 Protein, Human (HEK293, Llama Fc)

NKp46/NCR1 protein, a cytotoxicity-activating receptor on natural killer (NK) cells, potentially enhances their efficacy in tumor cell lysis. Interacting with CD247 and FCER1G, NKp46/NCR1 plays a pivotal role in signaling pathways associated with NK cell activation and cytotoxicity. It contributes to the regulatory network for recognizing and eliminating target cells, emphasizing its importance in immune surveillance and anti-tumor responses. NKp46/NCR1 Protein, Human (HEK293, Llama Fc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293, with C-Llama Fc labeled tag.

The NKp46/NCR1 protein serves as a cytotoxicity-activating receptor, potentially enhancing the efficacy of activated natural killer (NK) cells in mediating the lysis of tumor cells. This receptor interacts with CD247 and FCER1G, playing a pivotal role in the signaling pathways associated with NK cell activation and cytotoxicity against target cells. NKp46/NCR1 contributes to the intricate regulatory network involved in the recognition and elimination of target cells by activated NK cells, highlighting its importance in immune surveillance and anti-tumor responses.

Human

HEK293

C-Llama Fc

AAH64806 (Q22-N254)

9437

Partial

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQN

Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.