NR4A2 Protein, Human (P.pastoris, His)
Based on 1 Customer Validation
NR4A2, a crucial transcriptional regulator, is vital for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons. It plays a pivotal role in the expression of key genes (SLC6A3, SLC18A2, TH, DRD2) essential for mdDA neuron development. Interactions with SFPQ, NCOR2, SIN3A, HADC1, and PER2 contribute to its regulatory functions in mdDA neuron development, with the NCOR2 interaction influenced by the absence of PITX3. NR4A2 Protein, Human (P.pastoris, His) is the recombinant human-derived NR4A2 protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NR4A2, a crucial transcriptional regulator, is vital for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons. It plays a pivotal role in the expression of key genes (SLC6A3, SLC18A2, TH, DRD2) essential for mdDA neuron development. Interactions with SFPQ, NCOR2, SIN3A, HADC1, and PER2 contribute to its regulatory functions in mdDA neuron development, with the NCOR2 interaction influenced by the absence of PITX3. NR4A2 Protein, Human (P.pastoris, His) is the recombinant human-derived NR4A2 protein, expressed by P. pastoris , with N-His labeled tag.
Background
NR4A2, a key transcriptional regulator, holds significance in the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. Its pivotal role extends to the expression of crucial genes like SLC6A3, SLC18A2, TH, and DRD2, which are essential for the development of mdDA neurons. NR4A2 interacts with proteins such as SFPQ, NCOR2, SIN3A, and HADC1, with the interaction with NCOR2 being influenced by the absence of PITX3. Additionally, NR4A2 engages with PER2, contributing to its regulatory functions in the intricate processes associated with mdDA neuron development.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-His
-
Accession
P43354 (M1-F598)
-
Molecular Construction
-
N-term
-
His
-
NR4A2 (1M-598F)
Accession # P43354 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NR4A2; NGFI-B/Nur77 Beta-Type Transcription Factor Homolog; Prev. NURR1; Nur Related Protein-1, Human Homolog Of; TINUR; Orphan Nuclear Receptor NR4A2 Isoform 1; NOT; Orphan Nuclear Receptor NR4A2 Isoform 2; HZF-3; Intermediate-Early Receptor Protein; RNR
-
AA Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
-
Predicted Molecular Mass
68.6 kDa
-
Molecular Weight
Approximately 69 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
