1. Recombinant Proteins
  2. Others
  3. NTS Protein, Mouse (HEK293, Fc)

NTS1/NTSR1, the neurotensin receptor 1, potentially regulates fat metabolism through endocrine or paracrine mechanisms. Interacting with its ligand, neurotensin, NTS1/NTSR1 induces smooth muscle contraction. The receptor's interactions with neurotensin and other proteins like SORT1 and SORL1 suggest involvement in diverse cellular processes, indicating potential implications for fat metabolism regulation. NTS Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NTS protein, expressed by HEK293, with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NTS1/NTSR1, the neurotensin receptor 1, potentially regulates fat metabolism through endocrine or paracrine mechanisms. Interacting with its ligand, neurotensin, NTS1/NTSR1 induces smooth muscle contraction. The receptor's interactions with neurotensin and other proteins like SORT1 and SORL1 suggest involvement in diverse cellular processes, indicating potential implications for fat metabolism regulation. NTS Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived NTS protein, expressed by HEK293, with C-hFc labeled tag.

Background

NTS1/NTSR1, the neurotensin receptor 1, is involved in the potential endocrine or paracrine regulation of fat metabolism. Neurotensin, the ligand for NTSR1, is known to induce smooth muscle contraction (By similarity). NTS1/NTSR1 interacts with neurotensin and engages with other proteins such as SORT1 and SORL1, suggesting a role in various cellular processes and potential implications for the regulation of fat metabolism.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9D3P9 (S23-L162)

Gene ID
Molecular Construction
N-term
NTS (S23-L162)
Accession # Q9D3P9
hFc
C-term
Protein Length

Partial

Synonyms
neuromedin N; neurotensin/neuromedin N
AA Sequence

SDSEEDVRALEADLLTNMHTSKISKASPPSWKMTLLNVCSLINNVNSPAEEAGDMHDDDLVGKRKLPLVLDGFSLEAMLTIFQLQKICRSRAFQHWEIIQEDILDNVNDKNEKEEVIKRKIPYILKRQLYENKPRRPYIL

Molecular Weight

48-53 kDa

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NTS Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NTS Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NTS Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77817
Quantity:
MCE Japan Authorized Agent: