Nucleoprotein/NP Protein, HCoV-NL63 (sf9, His, myc)
Based on 1 Customer Validation
Nucleoprotein/NP proteins play a crucial role in assembling viral particles and facilitating the packaging of positive-strand viral genomic RNA into helical ribonucleocapsids (RNPs). Its interaction with the viral genome and membrane protein M is critical for virion assembly. Nucleoprotein/NP Protein, HCoV-NL63 (sf9, His, myc) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Nucleoprotein/NP proteins play a crucial role in assembling viral particles and facilitating the packaging of positive-strand viral genomic RNA into helical ribonucleocapsids (RNPs). Its interaction with the viral genome and membrane protein M is critical for virion assembly. Nucleoprotein/NP Protein, HCoV-NL63 (sf9, His, myc) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by sf9 insect cells , with C-Myc, N-10*His labeled tag.
Background
Nucleoprotein/NP Protein is a crucial player in the assembly of viral particles, orchestrating the packaging of the positive-strand viral genome RNA into a helical ribonucleocapsid (RNP). Its intricate interactions with the viral genome and the membrane protein M are fundamental to the virion assembly process. Beyond its structural role, NP Protein significantly contributes to the efficiency of subgenomic viral RNA transcription and overall viral replication. Existing as both monomeric and oligomeric forms, NP Protein forms homooligomers and engages in direct interactions with RNA. Furthermore, its association with NSP3 serves to tether the genome to the newly translated replicase-transcriptase complex at the early stages of infection, further highlighting its multifaceted involvement in the viral life cycle.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-Myc;N-10*His
-
Accession
Q6Q1R8 (M1-H377)
-
Gene ID2943504 [NCBI]
-
Molecular Construction
-
N-term
-
10*His
-
Nucleoprotein (M1-H377)
Accession # Q6Q1R8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Nucleoprotein; N; Nucleocapsid protein; NC; Protein N
-
AA Sequence
MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH
-
Predicted Molecular Mass
46.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 3% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
