Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His)
Based on 1 Customer Validation
Nucleoprotein/NP Protein is essential for influenza virus replication and transcription.It binds viral RNA, forming a complex for genome replication.NP Protein interacts with host proteins, aiding viral pathogenesis and immune evasion.Understanding NP Protein's functions is crucial for developing influenza antiviral strategies.Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Nucleoprotein/NP Protein is essential for influenza virus replication and transcription.It binds viral RNA, forming a complex for genome replication.NP Protein interacts with host proteins, aiding viral pathogenesis and immune evasion.Understanding NP Protein's functions is crucial for developing influenza antiviral strategies.Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Nucleoprotein (NP) plays a pivotal role in the influenza virus life cycle by encapsidating the negative-strand viral RNA, forming the ribonucleoprotein (RNP) complex that serves as a template for transcription and replication. Facilitating the initiation of the infectious cycle requires the active transport of the RNP into the host cell nucleus, a task accomplished by NP's nuclear localization signals through the cellular importin alpha/beta pathway. Later in infection, the nuclear export of RNPs involves interactions with viral proteins, including NEP and M1, possibly in association with host exportin-1/XPO1. Notably, NP homomultimerizes to create the nucleocapsid, and its dynamic interplay with M1, governed by acidification driven by the M2 protein, regulates the exposure of NP's nuclear localization signals, facilitating the targeted transport of the RNP to the nucleus. Furthermore, NP forms essential contacts with viral genomic RNA, relying on a combination of electrostatic interactions and planar interactions to mediate protein-RNA binding.
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P21433 (M1-N498)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Nucleoprotein (M1-N498)
Accession # P21433 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
Influenza A H2N2 (A/Ann Arbor/6/1960) Nucleoprotein / NP Protein (sf9, His)
-
AA Sequence
MASQGTKRSYEQMETDGERQNANEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELVLYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRKTRNAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEKEGYSLVGIDPFKLLQNSQVYSLIRPNENPAHKSQLVWMACNSAAFEDLRVSSFIRGTKVIPRGKLSTRGVQIASNENMDTMGSSTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPFDKPTIMAAFTGNAEGRTSDMRAEIIRMMEGAKPEEVSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAEEYDN
-
Predicted Molecular Mass
57 kDa
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 20% Glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
