1. Recombinant Proteins
  2. Viral Proteins
  3. Influenza Viruses Proteins
  4. Influenza Virus Nucleoprotein
  5. Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His)

Nucleoprotein/NP Protein is essential for influenza virus replication and transcription.It binds viral RNA, forming a complex for genome replication.NP Protein interacts with host proteins, aiding viral pathogenesis and immune evasion.Understanding NP Protein's functions is crucial for developing influenza antiviral strategies.Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

Nucleoprotein/NP Protein is essential for influenza virus replication and transcription.It binds viral RNA, forming a complex for genome replication.NP Protein interacts with host proteins, aiding viral pathogenesis and immune evasion.Understanding NP Protein's functions is crucial for developing influenza antiviral strategies.Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Nucleoprotein (NP) plays a pivotal role in the influenza virus life cycle by encapsidating the negative-strand viral RNA, forming the ribonucleoprotein (RNP) complex that serves as a template for transcription and replication. Facilitating the initiation of the infectious cycle requires the active transport of the RNP into the host cell nucleus, a task accomplished by NP's nuclear localization signals through the cellular importin alpha/beta pathway. Later in infection, the nuclear export of RNPs involves interactions with viral proteins, including NEP and M1, possibly in association with host exportin-1/XPO1. Notably, NP homomultimerizes to create the nucleocapsid, and its dynamic interplay with M1, governed by acidification driven by the M2 protein, regulates the exposure of NP's nuclear localization signals, facilitating the targeted transport of the RNP to the nucleus. Furthermore, NP forms essential contacts with viral genomic RNA, relying on a combination of electrostatic interactions and planar interactions to mediate protein-RNA binding.

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

P21433 (M1-N498)

Gene ID

/

Molecular Construction
N-term
Nucleoprotein (M1-N498)
Accession # P21433
His
C-term
Protein Length

Full Length

Synonyms
Influenza A H2N2 (A/Ann Arbor/6/1960) Nucleoprotein / NP Protein (sf9, His)
AA Sequence

MASQGTKRSYEQMETDGERQNANEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYKRVDGKWMRELVLYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRKTRNAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEKEGYSLVGIDPFKLLQNSQVYSLIRPNENPAHKSQLVWMACNSAAFEDLRVSSFIRGTKVIPRGKLSTRGVQIASNENMDTMGSSTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPFDKPTIMAAFTGNAEGRTSDMRAEIIRMMEGAKPEEVSFQGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAEEYDN

Predicted Molecular Mass
57 kDa
Peso molecular

Approximately 52 kDa,based on SDS-PAGE under reducing conditions.

Pureza

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0, 20% Glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación
Referencias

Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Nucleoprotein/NP Protein, H2N2 (P21433, sf9, His)
Cat. No.:
HY-P74674
Cantidad:
MCE Japan Authorized Agent: