1. Recombinant Proteins
  2. Others
  3. OBCAM/OPCML Protein, Rat (HEK293, Fc)

OBCAM/OPCML Protein, Rat (HEK293, Fc)

Cat. No.: HY-P77115
COA Handling Instructions

OBCAM/OPCML Protein binds opioids in acidic lipid environments, influencing cellular communication and facilitating cell contact, potentially impacting various biological processes. OBCAM/OPCML Protein, Rat (HEK293, Fc) is the recombinant rat-derived OBCAM/OPCML protein, expressed by HEK293, with C-hFc labeled tag. The total length of OBCAM/OPCML Protein, Rat (HEK293, Fc) is 294 a.a., with molecular weight of ~59 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $65 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OBCAM/OPCML Protein binds opioids in acidic lipid environments, influencing cellular communication and facilitating cell contact, potentially impacting various biological processes. OBCAM/OPCML Protein, Rat (HEK293, Fc) is the recombinant rat-derived OBCAM/OPCML protein, expressed by HEK293, with C-hFc labeled tag. The total length of OBCAM/OPCML Protein, Rat (HEK293, Fc) is 294 a.a., with molecular weight of ~59 KDa.

Background

The OBCAM/OPCML protein functions by binding to opioids in the presence of acidic lipids, potentially playing a role in cellular communication. This protein is involved in facilitating cell contact and may have implications in various biological processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat OBCAM at 1 μg/mL (100 μL/well) can bind biotinylated human LSAMP. The ED50 for this effect is 0.7336 μg/mL.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P32736 (G28-V321)

Gene ID

116597  [NCBI]

Molecular Construction
N-term
OPCML (G28-V321)
Accession # P32736
hFc
C-term
Synonyms
Opioid-binding protein/cell adhesion molecule; OBCAM; OPCML; IGLON1
AA Sequence

GVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEISSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGV

Molecular Weight

Approximately 90 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

OBCAM/OPCML Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OBCAM/OPCML Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P77115
Quantity:
MCE Japan Authorized Agent: