Olfactory Marker Protein/OMP Protein, Human (His)
Based on 1 Customer Validation
OMP Protein acts as a modulator in the olfactory signal-transduction cascade, finely tuning olfactory signaling processes. Interacting with BEX1 and BEX2, OMP suggests potential associations with proteins in cellular processes, emphasizing its multifaceted role in the intricate olfactory signal transduction network and implying broader involvement in the molecular framework of olfactory function. Olfactory Marker Protein/OMP Protein, Human (His) is the recombinant human-derived Olfactory Marker protein/OMP protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OMP Protein acts as a modulator in the olfactory signal-transduction cascade, finely tuning olfactory signaling processes. Interacting with BEX1 and BEX2, OMP suggests potential associations with proteins in cellular processes, emphasizing its multifaceted role in the intricate olfactory signal transduction network and implying broader involvement in the molecular framework of olfactory function. Olfactory Marker Protein/OMP Protein, Human (His) is the recombinant human-derived Olfactory Marker protein/OMP protein, expressed by E. coli , with N-His labeled tag.
Background
The Olfactory Marker Protein (OMP) serves as a potential modulator within the olfactory signal-transduction cascade, playing a key role in fine-tuning olfactory signaling processes. In addition to its regulatory function, OMP interacts with BEX1 and BEX2, indicating a potential association with other proteins involved in cellular processes. This dual role highlights the multifaceted nature of OMP in influencing the intricacies of olfactory signal transduction, suggesting its involvement in the broader molecular network underlying olfactory function.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P47874 (M1-L163)
-
Molecular Construction
-
N-term
-
His
-
OMP (M1-L163)
Accession # P47874 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
OMP; Olfactory Neuronal-Specific Protein; Olfactory Marker Protein
-
AA Sequence
MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
-
Molecular Weight
Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
