Osteomodulin Protein, Human (HEK293, His)
Based on 1 Customer Validation
Osteomodulin is a potential contributor to the biomineralization process, exerting its functional role through α(V)β(3)-integrin binding to osteoblasts. This interaction highlights its importance in bone-related cellular activities, affecting osteoblast function and potentially bone formation and remodeling. Osteomodulin Protein, Human (HEK293, His) is the recombinant human-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Osteomodulin is a potential contributor to the biomineralization process, exerting its functional role through α(V)β(3)-integrin binding to osteoblasts. This interaction highlights its importance in bone-related cellular activities, affecting osteoblast function and potentially bone formation and remodeling. Osteomodulin Protein, Human (HEK293, His) is the recombinant human-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag.
Background
Osteomodulin Protein emerges as a potential player in biomineralization processes, hinting at its involvement in the intricate mechanisms of mineral deposition. Notably, the protein demonstrates a functional role in binding osteoblasts through the alpha(V)beta(3)-integrin, suggesting a pivotal interaction in bone-related cellular activities. Additionally, Osteomodulin directly binds the alpha(V)beta(3)-integrin, further underscoring its significance in mediating interactions crucial for osteoblast function and potentially influencing processes related to bone formation and remodeling. Elucidating the specific molecular mechanisms and downstream effects of Osteomodulin's interactions with the alpha(V)beta(3)-integrin could provide valuable insights into its role in biomineralization and bone physiology.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q99983 (Q21-E421)
-
Molecular Construction
-
N-term
-
Osteomodulin (Q21-E421)
Accession # Q99983 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
OMD; Keratan Sulfate Proteoglycan Osteomodulin; Osteomodulin; Osteoadherin Proteoglycan; SLRR2C; KSPG Osteomodulin; Osteoadherin; OSAD
-
AA Sequence
QYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQE
-
Predicted Molecular Mass
48.3 kDa
-
Molecular Weight
Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
