Osteomodulin Protein, Mouse (HEK293, His)

Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Mouse Osteomodulin can significantly enhance the rate of type I collagen fibrillogenesis.

• 
  Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Mouse Osteomodulin can significantly enhance the rate of type I collagen fibrillogenesis.

Mouse

HEK293

C-10*His

O35103 (Q21-I423)

27047

Full Length

QYEAYRWDDDYDQEPNEDYDPEFQFHQNIEYGVPFYNNILGCAKECFCPTNFPTSMYCDNRKLKTIPIIPMHIQQLNLQFNDIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLSNLQQLHLEHNNLEEFPFPLPKSLERLLLGYNEISILPTNAMDGLVNVTMLDLCYNHLSDSMLKEKTLSKMEKLMQLNLCNNRLESMPLGLPSSLMYLSLENNSISSIPDNYFDKLPKLHALRISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIPRNLEHLYLQNNEIESINVTMICPSPDPVHHHHLTYLRVDQNKLKEPISSYIFFCFPRIHSIYYGEQRSTNGETIQLKTQVFRSYQEEEEEDDHDSQDNTLEGQEVSDEHYNSHYYEMQEWQDTI

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.