Otolin-1 Protein, Human (HEK293, His)

Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle). Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Otolin-1 is a collagen-like protein with specific expression in the inner ear, functioning as a crucial component in the formation of otoconia—an essential calcium carbonate structure located in the saccule and utricle of the ear. This protein acts as an organic scaffold, facilitating biomineralization by sequestering calcium and forming interconnecting fibrils between otoconia. Otolin-1's involvement in this process is further highlighted by its incorporation into the calcium crystal structure. Alongside OC90, Otolin-1 plays a role in modulating calcite crystal morphology and growth kinetics. The protein exists as a homooligomer, likely forming homotrimers through disulfide linkages. Additionally, Otolin-1 interacts with OC90 and CBLN1, underscoring its intricate involvement in the molecular interactions crucial for inner ear function. (

Human

HEK293

C-6*His

A6NHN0 (K24-P477)

131149  [NCBI]

Full Length of Mature Protein

KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP

Approximately 84-94 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.