Otolin-1 Protein, Human (HEK293, His)
Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle). Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Otolin-1 is a collagen-like protein that shows specific expression in the inner ear, where it is a key component that provides the organic scaffolding for the otic bulb (the calcium carbonate structure found in the otic bulb and utricle). Otolin-1 plays a key role as a scaffold in the biomineralization process by chelating calcium and forming interconnected fibrils between otoliths, thereby integrating into the calcium crystal structure. Otolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Otolin-1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Otolin-1 is a collagen-like protein with specific expression in the inner ear, functioning as a crucial component in the formation of otoconia—an essential calcium carbonate structure located in the saccule and utricle of the ear. This protein acts as an organic scaffold, facilitating biomineralization by sequestering calcium and forming interconnecting fibrils between otoconia. Otolin-1's involvement in this process is further highlighted by its incorporation into the calcium crystal structure. Alongside OC90, Otolin-1 plays a role in modulating calcite crystal morphology and growth kinetics. The protein exists as a homooligomer, likely forming homotrimers through disulfide linkages. Additionally, Otolin-1 interacts with OC90 and CBLN1, underscoring its intricate involvement in the molecular interactions crucial for inner ear function. (
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
A6NHN0 (K24-P477)
-
Gene ID131149 [NCBI]
-
Molecular Construction
-
N-term
-
Otolin-1 (K24-P477)
Accession # A6NHN0 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
OTOL1; C1q And TNF Related 16; Otolin 1; Otolin-1; C1QTNF15; C1q And Tumor Necrosis Factor Related Protein 15; C1QTNF16; Otolin 1 Homolog (Zebrafish)
-
AA Sequence
KTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPITKPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVGPQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGDQGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRNGLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLSKPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP
-
Predicted Molecular Mass
47.7 kDa
-
Molecular Weight
Approximately 84-94 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
