Outer membrane protein A/OmpA Protein, E.coli (His-SUMO)

Outer membrane protein A (OmpA) ensures the structural integrity of the bacterial cell wall and cooperates with TolR to stabilize the peptidoglycan layer. As a porin, OmpA controls the permeability of small solutes. Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane protein A/OmpA protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is 183 a.a., with molecular weight of ~35.6 kDa.

Outer membrane protein A (OmpA) plays a crucial role in the structural integrity of the bacterial cell wall, working in concert with TolR to maintain the position of the peptidoglycan layer in the periplasm. Functioning as a porin, OmpA exhibits low permeability, facilitating the gradual penetration of small solutes through its structure. The internal gate within OmpA further regulates the passage of solutes, influencing the selective transport of molecules. Additionally, OmpA's significance extends to its involvement in conjugation with F-type plasmids, where it likely serves as the essential mating receptor on recipient cells, contributing to the horizontal transfer of genetic material.

E.coli

E. coli

N-SUMO;N-6*His

P0A911 (W164-A346)

917123  [NCBI]

WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Approximately 35.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.