p30 Protein, African swine fever virus

p30 protein, pivotal in ASFV infection, influences HNRNPK's subcellular distribution, potentially affecting mRNA processing. This interaction underscores p30's role in vital molecular events for ASFV infection. Essential for virus internalization, p30 forms oligomers and interacts with host HNRNPK, emphasizing its significance in the viral life cycle and host-pathogen interactions during ASFV infection. p30 Protein, African swine fever virus is the recombinant Virus-derived p30 protein, expressed by E. coli , with tag free.

p30 protein, a key player in ASFV (African Swine Fever Virus) infection, exerts its influence on the subcellular distribution of heterogeneous nuclear ribonucleoprotein K (HNRNPK), potentially impacting HNRNPK's functions related to mRNA processing and export. This interaction underscores p30's role in orchestrating molecular events crucial for ASFV infection. Additionally, p30 is essential for the internalization of the virus, further emphasizing its significance in the viral life cycle. The protein forms oligomers and interacts with host HNRNPK, suggesting its involvement in intricate host-pathogen interactions during ASFV infection.

Virus

E. coli

Tag Free

P34204 (D2-F204)

22220322

Partial

DFILNISMKMEVIFKTDLRSSSQVVFHAGSLYNWFSVEIINSGRIVTTAIKTLLSTVKYDIVKSAHIYAGQGYTEHQAQEEWNMILHVLFEEETESSASSESIHEKNDNETNECTSSFETLFEQEPSSEEPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIHGTPLKEEEKEVVRLMVIKLLKKNKLLSHLHLMF

Predicted band size: 23.5 KDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 10% glycerol, 1 mM DTT.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.