p53 Protein, Rhesus Macaque

p53 protein, a tumor suppressor, induces growth arrest or apoptosis in various tumors, regulating cell division through gene control, including cyclin-dependent kinase inhibitors. It stimulates BAX and FAS antigen expression or represses Bcl-2 to induce apoptosis. p53's multifaceted role underscores its importance in orchestrating cellular responses, maintaining genomic integrity, and countering aberrant cell proliferation. p53 Protein, Rhesus Macaque is the recombinant Rhesus Macaque-derived p53 protein, expressed by E. coli , with tag free.

p53 protein functions as a tumor suppressor in numerous tumor types, exerting its effects through the induction of growth arrest or apoptosis depending on the physiological conditions and cell type. In the realm of cell cycle regulation, p53 acts as a trans-activator that negatively regulates cell division by overseeing a set of genes crucial for this process, including an inhibitor of cyclin-dependent kinases. Apoptosis induction by p53 is thought to occur through the stimulation of BAX and FAS antigen expression or repression of Bcl-2 expression. The multifaceted role of p53 underscores its significance in orchestrating cellular responses to maintain genomic integrity and counteract aberrant cell proliferation.

Rhesus Macaque

E. coli

Tag Free

E3U906 (M1-D393)

716170  [NCBI]

Full Length

MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGPDEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAKSVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPAGSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD

Approximately 48 kDa, based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.