1. Recombinant Proteins
  2. Others
  3. PDCD5 Protein, Human (His)

PDCD5 Protein, Human (His)

Cat. No.: HY-P71019
COA Handling Instructions

PDCD5 Protein is implicated in apoptosis, highlighting its potential role in regulating programmed cell death and maintaining cellular homeostasis. Despite this functional attribution, the specific molecular interactions and pathways involving PDCD5 in apoptosis require further exploration for a comprehensive understanding of its significance in cellular fate determination and survival mechanisms. PDCD5 Protein, Human (His) is the recombinant human-derived PDCD5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PDCD5 Protein, Human (His) is 125 a.a., with molecular weight of ~22 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $180 In-stock
50 μg $500 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDCD5 Protein is implicated in apoptosis, highlighting its potential role in regulating programmed cell death and maintaining cellular homeostasis. Despite this functional attribution, the specific molecular interactions and pathways involving PDCD5 in apoptosis require further exploration for a comprehensive understanding of its significance in cellular fate determination and survival mechanisms. PDCD5 Protein, Human (His) is the recombinant human-derived PDCD5 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PDCD5 Protein, Human (His) is 125 a.a., with molecular weight of ~22 kDa.

Background

The PDCD5 Protein appears to play a role in the process of apoptosis, suggesting its potential involvement in the intricate cellular mechanisms that regulate programmed cell death. This functional attribution underscores PDCD5's significance in orchestrating pathways associated with apoptosis, which is a crucial physiological process essential for maintaining cellular homeostasis. The precise molecular interactions and pathways through which PDCD5 contributes to apoptosis remain to be fully elucidated, inviting further exploration into its role as a key player in cellular fate determination and survival mechanisms.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O14737 (M1-Y125)

Gene ID
Molecular Construction
N-term
6*His
PDCD5 (M1-Y125)
Accession # O14737
C-term
Synonyms
Programmed Cell Death Protein 5; TF-1 Cell Apoptosis-Related Protein 19; Protein TFAR19; PDCD5; TFAR19
AA Sequence

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Molecular Weight

Approximately 22 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

PDCD5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDCD5 Protein, Human (His)
Cat. No.:
HY-P71019
Quantity:
MCE Japan Authorized Agent: