PDCD5 Protein, Human (His)
PDCD5 Protein is implicated in apoptosis, highlighting its potential role in regulating programmed cell death and maintaining cellular homeostasis. Despite this functional attribution, the specific molecular interactions and pathways involving PDCD5 in apoptosis require further exploration for a comprehensive understanding of its significance in cellular fate determination and survival mechanisms. PDCD5 Protein, Human (His) is the recombinant human-derived PDCD5 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PDCD5 Protein is implicated in apoptosis, highlighting its potential role in regulating programmed cell death and maintaining cellular homeostasis. Despite this functional attribution, the specific molecular interactions and pathways involving PDCD5 in apoptosis require further exploration for a comprehensive understanding of its significance in cellular fate determination and survival mechanisms. PDCD5 Protein, Human (His) is the recombinant human-derived PDCD5 protein, expressed by E. coli , with N-6*His labeled tag.
The PDCD5 Protein appears to play a role in the process of apoptosis, suggesting its potential involvement in the intricate cellular mechanisms that regulate programmed cell death. This functional attribution underscores PDCD5's significance in orchestrating pathways associated with apoptosis, which is a crucial physiological process essential for maintaining cellular homeostasis. The precise molecular interactions and pathways through which PDCD5 contributes to apoptosis remain to be fully elucidated, inviting further exploration into its role as a key player in cellular fate determination and survival mechanisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O14737 (M1-Y125)
-
Molecular Construction
-
N-term
-
6*His
-
PDCD5 (M1-Y125)
Accession # O14737 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PDCD5; Programmed Cell Death Protein 5; Programmed Cell Death 5; TFAR19 Novel Apoptosis-Related; TFAR19; MGC9294; TF-1 Cell Apoptosis-Related Protein 19; Protein TFAR19; TF1 Cell Apoptosis-Related Gene 19
-
AA Sequence
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
-
Predicted Molecular Mass
16.4 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
