PEA15 Protein, Human
The PEA15 protein is a regulator of multiple cellular processes that blocks Ras-mediated integrin inhibition and modulates the ERK MAP kinase cascade. It inhibits RPS6KA3 activity by sequestering RPS6KA3 in the cytoplasm, regulating key cellular pathways. PEA15 Protein, Human is the recombinant human-derived PEA15 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PEA15 protein is a regulator of multiple cellular processes that blocks Ras-mediated integrin inhibition and modulates the ERK MAP kinase cascade. It inhibits RPS6KA3 activity by sequestering RPS6KA3 in the cytoplasm, regulating key cellular pathways. PEA15 Protein, Human is the recombinant human-derived PEA15 protein, expressed by E. coli , with tag free.
Background
The PEA15 protein exerts diverse regulatory functions in cellular processes, including blocking Ras-mediated inhibition of integrin activation and modulating the ERK MAP kinase cascade. PEA15 plays a pivotal role in inhibiting the activities of RPS6KA3 by sequestering it in the cytoplasm, thereby regulating key cellular pathways. Additionally, PEA15 serves as a potent inhibitor of both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Its involvement extends to the regulation of glucose transport, wherein PEA15 controls the content of SLC2A1 glucose transporters on the plasma membrane and modulates the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface. Functionally, PEA15 forms transient interactions with PLD1 and PLD2, further contributing to its intricate regulatory network. Notably, PEA15 engages in direct interactions with key cellular players such as RPS6KA3, MAPK3, MAPK1, CASP8, and FADD, underscoring its multifaceted role in cellular signaling and homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q15121 ( M1-A130)
-
Molecular Construction
-
N-term
-
PEA15 ( M1-A130)
Accession # Q15121 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PEA15; PEA-15; Proliferation And Apoptosis Adaptor Protein 15; HMAT1; PED; MAT1H; 15 KDa Phosphoprotein Enriched In Astrocytes; MAT1; Phosphoprotein Enriched In Diabetes; Phosphoprotein Enriched In Astrocytes 15; Astrocytic Phosphoprotein PEA-15; Prolifer
-
AA Sequence
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
-
Predicted Molecular Mass
15.3 kDa
-
Molecular Weight
Approximately 12—16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)