Peptide deformylase Protein, S. aureus (P.pastoris, His)

Peptide deformylase, a crucial enzyme in protein biosynthesis, catalyzes the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. Displaying broad specificity at positions beyond the N-terminal L-methionine, the enzyme ensures proper maturation and functionality of proteins, emphasizing its essential contribution to the intricate process of protein synthesis and modification. Peptide deformylase Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Peptide deformylase protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Peptide deformylase Protein, S. aureus (P.pastoris, His) is 183 a.a., with molecular weight of ~25 kDa.

Peptide deformylase, a crucial enzyme in protein biosynthesis, plays a pivotal role in cellular processes by catalyzing the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. While it requires at least a dipeptide for optimal efficiency, the enzyme displays broad specificity at positions beyond the N-terminal L-methionine. This activity ensures the proper maturation and functionality of proteins, highlighting the essential contribution of peptide deformylase in the intricate process of protein synthesis and modification.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Staphylococcus aureus

P. pastoris

N-6*His

P68826 (1M-183V)

/

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

Approximately 25 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.