1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His)

PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His)

Cat. No.: HY-P790010
Handling Instructions Technical Support

Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His) is the recombinant human-derived Peroxiredoxin-1 protein, expressed by P. pastoris , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Peroxiredoxin-1 (PRDX1) is a thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides and plays a crucial role in cellular protection against oxidative stress. It detoxifies peroxide and senses hydrogen peroxide-mediated signaling events. PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His) is the recombinant human-derived Peroxiredoxin-1 protein, expressed by P. pastoris , with C-6*His labeled tag.

Background

Peroxiredoxin-1 (PRDX1), a thiol-specific peroxidase, serves as a catalytic agent in the reduction of hydrogen peroxide and organic hydroperoxides, converting them into water and alcohols, respectively. Its crucial role in cellular protection against oxidative stress involves detoxifying peroxides and acting as a sensor for hydrogen peroxide-mediated signaling events. PRDX1 may also contribute to the signaling cascades initiated by growth factors and tumor necrosis factor-alpha, potentially influencing intracellular H(2)O(2) concentrations. Notably, PRDX1 exhibits the ability to reduce an intramolecular disulfide bond in GDPD5, modulating GDPD5's capacity to drive postmitotic motor neuron differentiation. These multifaceted functions underscore PRDX1's intricate involvement in redox signaling and cellular differentiation processes.

Species

Human

Source

P. pastoris

Tag

C-6*His

Accession

Q06830 (M1-K199)

Gene ID

5052

Molecular Construction
N-term
Peroxiredoxin-1 (M1-K199)
Accession # Q06830
6*His
C-term
Protein Length

Full Length

Synonyms
PRDX1; PAG; OSF3; Paga; PrxI; TDX2; TPxA; prx1; MSP23
AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

분자량

Approximately 22.1 KDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
PRDX1/Peroxiredoxin-1 Protein, Human (P. pastoris, His)
Cat. No.:
HY-P790010
수량:
MCE Japan Authorized Agent: