1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Persephin Protein, Human

Persephin Protein, Human

Cat. No.: HY-P71034
COA Handling Instructions

Persephin protein is a disulfide-linked homodimer with neurotrophic activity that specifically benefits midbrain dopaminergic and motor neurons. Its unique ability to target these populations suggests that it plays a special role in supporting their survival and function. Persephin Protein, Human is the recombinant human-derived Persephin protein, expressed by E. coli , with tag free. The total length of Persephin Protein, Human is 96 a.a., with molecular weight of ~12.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $93 In-stock
50 μg $260 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Persephin protein is a disulfide-linked homodimer with neurotrophic activity that specifically benefits midbrain dopaminergic and motor neurons. Its unique ability to target these populations suggests that it plays a special role in supporting their survival and function. Persephin Protein, Human is the recombinant human-derived Persephin protein, expressed by E. coli , with tag free. The total length of Persephin Protein, Human is 96 a.a., with molecular weight of ~12.0 kDa.

Background

Persephin protein, a homodimer formed through disulfide linkages, demonstrates neurotrophic activity specifically targeting mesencephalic dopaminergic and motor neurons. The unique ability of Persephin to exert its neurotrophic effects on these specific neuronal populations suggests a specialized role in supporting and promoting the survival or function of dopaminergic and motor neurons. The homodimeric structure highlights the significance of the disulfide linkages in maintaining the integrity and functionality of Persephin, emphasizing its potential impact on neuronal development and maintenance within the mesencephalic region.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O60542 (A61-G156)

Gene ID
Molecular Construction
N-term
Persephin (A61-G156)
Accession # O60542
C-term
Synonyms
Persephin; PSP; PSPN
AA Sequence

ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

Molecular Weight

Approximately 12.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Persephin Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Persephin Protein, Human
Cat. No.:
HY-P71034
Quantity:
MCE Japan Authorized Agent: