Persephin Protein, Human

Customer Review

Based on 1 Customer Validation

Persephin protein is a disulfide-linked homodimer with neurotrophic activity that specifically benefits midbrain dopaminergic and motor neurons. Its unique ability to target these populations suggests that it plays a special role in supporting their survival and function. Persephin Protein, Human is the recombinant human-derived Persephin protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Persephin protein is a disulfide-linked homodimer with neurotrophic activity that specifically benefits midbrain dopaminergic and motor neurons. Its unique ability to target these populations suggests that it plays a special role in supporting their survival and function. Persephin Protein, Human is the recombinant human-derived Persephin protein, expressed by E. coli , with tag free.

Background

Persephin protein, a homodimer formed through disulfide linkages, demonstrates neurotrophic activity specifically targeting mesencephalic dopaminergic and motor neurons. The unique ability of Persephin to exert its neurotrophic effects on these specific neuronal populations suggests a specialized role in supporting and promoting the survival or function of dopaminergic and motor neurons. The homodimeric structure highlights the significance of the disulfide linkages in maintaining the integrity and functionality of Persephin, emphasizing its potential impact on neuronal development and maintenance within the mesencephalic region.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Persephin (A61-G156)
      Accession # O60542
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PSPN; PSP; Persephin

  • AA Sequence

    ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

  • Predicted Molecular Mass

    10.4 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00