1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PET hydrolase Protein, Thermobifida alba (261a.a, His, Strep)

PET hydrolase Protein, Thermobifida alba (261a.a, His, Strep)

Cat. No.: HY-P703521
Handling Instructions Technical Support

PET hydrolase Protein, Thermobifida alba (261a.a, His, Strep) is the recombinant PET hydrolase, expressed by E. coli , with Strep, His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PET hydrolase Protein, Thermobifida alba (261a.a, His, Strep) is the recombinant PET hydrolase, expressed by E. coli , with Strep, His labeled tag. ,

Background

PET hydrolase is an enzyme that catalyzes the hydrolysis of cutin, a polyester forming the structure of plant cuticle, and exhibits esterase activity towards p-nitrophenol-linked aliphatic esters (pNP-aliphatic esters). It is capable of degrading poly(ethylene terephthalate) (PET), the most abundant polyester plastic globally (by similarity), and can depolymerize various synthetic polyesters, including poly(epsilon-caprolactone) (PCL), poly(butylene succinate-co-adipate) (PBSA), poly(butylene succinate) (PBS), and poly(lactic acid) (PLA).

Species

Others

Source

E. coli

Tag

Strep;His

Accession

F7IX06 (A40-F300)

Gene ID

/

Protein Length

Full Length of Mature Protein

Synonyms
Cutinase est2; Poly(ethylene terephthalate) hydrolase; PET hydrolase; PETase; 3.1.1.101; TaCut2; est2; est119; Thermobifida alba; Thermomonospora alba; Hydrolase; Serine esterase; 3.1.1.74
AA Sequence

ANPYERGPNPTESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYTGTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAPNITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTGLLSDVEEYRSTCPF

Predicted Molecular Mass
31.1 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris (pH 7.5), 200mM NaCl, 20% Glycerol, 1mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PET hydrolase Protein, Thermobifida alba (261a.a, His, Strep) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PET hydrolase Protein, Thermobifida alba (261a.a, His, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PET hydrolase Protein, Thermobifida alba (261a.a, His, Strep)
Cat. No.:
HY-P703521
Quantity:
MCE Japan Authorized Agent: