PHLDA2 Protein, Human (His)

PHLDA2 protein regulates placenta growth, potentially through its PH domain, which competes with other PH domain-containing proteins, hindering their binding to membrane lipids. PHLDA2 Protein, Human (His) is the recombinant human-derived PHLDA2 protein, expressed by E. coli , with C-6*His labeled tag.

PHLDA2 protein is involved in the regulation of placenta growth. It likely exerts its effects through its PH domain, which competes with other PH domain-containing proteins, thereby hindering their binding to membrane lipids.

Human

E. coli

C-6*His

Q53GA4 (M1-P152)

7262  [NCBI]

Full Length

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Approximately 14-25 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM hepes, 50 mM NaCl, 200 mM Arginine-HCl, 6% trehalose, 4% mannitol, 5 mM DTT, 0.05% Tween 20, pH 7.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.