1. Recombinant Proteins
  2. Others
  3. PHLDA2 Protein, Human (His)

PHLDA2 Protein, Human (His)

Cat. No.: HY-P71202
Handling Instructions

PHLDA2 protein regulates placenta growth, potentially through its PH domain, which competes with other PH domain-containing proteins, hindering their binding to membrane lipids. PHLDA2 Protein, Human (His) is the recombinant human-derived PHLDA2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of PHLDA2 Protein, Human (His) is 152 a.a., with molecular weight of 14-25 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PHLDA2 protein regulates placenta growth, potentially through its PH domain, which competes with other PH domain-containing proteins, hindering their binding to membrane lipids. PHLDA2 Protein, Human (His) is the recombinant human-derived PHLDA2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of PHLDA2 Protein, Human (His) is 152 a.a., with molecular weight of 14-25 kDa.

Background

PHLDA2 protein is involved in the regulation of placenta growth. It likely exerts its effects through its PH domain, which competes with other PH domain-containing proteins, thereby hindering their binding to membrane lipids.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q53GA4 (M1-P152)

Gene ID
Molecular Construction
N-term
PHLDA2 (M1-P152)
Accession # Q53GA4
6*His
C-term
Synonyms
Pleckstrin Homology-Like Domain Family A Member 2; Beckwith-Wiedemann Syndrome Chromosomal Region 1 Candidate Gene C Protein; Imprinted in Placenta and Liver Protein; Tumor-Suppressing STF cDNA 3 Protein; Tumor-Suppressing Subchromosomal Transferable Fragment
AA Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Molecular Weight

14-25 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PHLDA2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PHLDA2 Protein, Human (His)
Cat. No.:
HY-P71202
Quantity:
MCE Japan Authorized Agent: