PHS Protein, Human (His)
PHS protein is crucial in tetrahydrobiopterin biosynthesis and has the dual function of hindering the formation of 7-pterin and promoting quinone-BH2. It also acts as a coactivator of HNF1A-dependent transcription, affecting HNF1A dimerization and enhancing its activity. PHS Protein, Human (His) is the recombinant human-derived PHS protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PHS protein is crucial in tetrahydrobiopterin biosynthesis and has the dual function of hindering the formation of 7-pterin and promoting quinone-BH2. It also acts as a coactivator of HNF1A-dependent transcription, affecting HNF1A dimerization and enhancing its activity. PHS Protein, Human (His) is the recombinant human-derived PHS protein, expressed by E. coli , with N-6*His labeled tag.
PHS protein plays a crucial role in tetrahydrobiopterin biosynthesis, demonstrating its involvement in essential cellular processes. It appears to exhibit a dual function, acting to hinder the formation of 7-pterins while simultaneously expediting the formation of quinonoid-BH2. Beyond its role in tetrahydrobiopterin biosynthesis, PHS serves as a coactivator for HNF1A-dependent transcription, contributing to the regulation of gene expression. Notably, PHS influences the dimerization of the homeodomain protein HNF1A, augmenting its transcriptional activity. Furthermore, it acts as a coactivator in HNF1B-dependent transcription, showcasing its versatility in modulating various transcriptional processes. These multifaceted functions underscore the significance of PHS in cellular pathways and transcriptional regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P61457-1 (A2-T104)
-
Molecular Construction
-
N-term
-
6*His
-
PHS (A2-T104)
Accession # P61457-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
PCBD1; Dimerizing Cofactor For HNF1; Prev. PCBD; Pterin-4 Alpha-Carbinolamine Dehydratase/Dimerization Cofactor Of Hepatocyte Nuclear Factor 1 Alpha (TCF1); Prev. DCOH; Pterin-4a-Carbinolamine Dehydratase (Dimerization Cofactor Of Hepatic Nuclear Factor 1
-
AA Sequence
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
