PHS Protein, Human (His)

PHS protein is crucial in tetrahydrobiopterin biosynthesis and has the dual function of hindering the formation of 7-pterin and promoting quinone-BH2. It also acts as a coactivator of HNF1A-dependent transcription, affecting HNF1A dimerization and enhancing its activity. PHS Protein, Human (His) is the recombinant human-derived PHS protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PHS protein is crucial in tetrahydrobiopterin biosynthesis and has the dual function of hindering the formation of 7-pterin and promoting quinone-BH2. It also acts as a coactivator of HNF1A-dependent transcription, affecting HNF1A dimerization and enhancing its activity. PHS Protein, Human (His) is the recombinant human-derived PHS protein, expressed by E. coli , with N-6*His labeled tag.

Background

PHS protein plays a crucial role in tetrahydrobiopterin biosynthesis, demonstrating its involvement in essential cellular processes. It appears to exhibit a dual function, acting to hinder the formation of 7-pterins while simultaneously expediting the formation of quinonoid-BH2. Beyond its role in tetrahydrobiopterin biosynthesis, PHS serves as a coactivator for HNF1A-dependent transcription, contributing to the regulation of gene expression. Notably, PHS influences the dimerization of the homeodomain protein HNF1A, augmenting its transcriptional activity. Furthermore, it acts as a coactivator in HNF1B-dependent transcription, showcasing its versatility in modulating various transcriptional processes. These multifaceted functions underscore the significance of PHS in cellular pathways and transcriptional regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PHS (A2-T104)
      Accession # P61457-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    PCBD1; Dimerizing Cofactor For HNF1; Prev. PCBD; Pterin-4 Alpha-Carbinolamine Dehydratase/Dimerization Cofactor Of Hepatocyte Nuclear Factor 1 Alpha (TCF1); Prev. DCOH; Pterin-4a-Carbinolamine Dehydratase (Dimerization Cofactor Of Hepatic Nuclear Factor 1

  • AA Sequence

    AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

  • Predicted Molecular Mass

    14.2 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00