PILR-alpha Protein, Human (178a.a, HEK293, Fc)

PILR-α is a member of the paired receptor family and functions as an inhibitory signaling receptor in immune regulation. It inhibits signal transduction by recruiting the phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, blocking the phosphorylation of key signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, Fc) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-hFc labeled tag. The total length of PILR-alpha Protein, Human (178a.a, HEK293, Fc) is 178 a.a., with molecular weight of 60-70 kDa.

PILR-alpha, belonging to the paired receptors family, functions as a cellular signaling inhibitory receptor with a role in immune system regulation. This receptor is presumed to exert its inhibitory effects by recruiting cytoplasmic phosphatases such as PTPN6/SHP-1 and PTPN11/SHP-2 through their SH2 domains, leading to signal transduction blockage via dephosphorylation of key signaling molecules. Additionally, PILR-alpha serves as a receptor for PIANP and, under conditions of microbial infection, acts as an entry co-receptor for herpes simplex virus 1. Its engagement in these molecular interactions highlights its versatile involvement in immune modulation and cellular responses to pathogens.

Human

HEK293

C-hFc

Q9UKJ1 (Q20-A197)

29992  [NCBI]

QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETA

60-70 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.