PILR-alpha Protein, Human (178a.a, HEK293, His)
Based on 1 Customer Validation
Paired immunoglobulin-like type 2 receptor alpha (PILRA) is a immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing member of the paired receptor which consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction such as SH1 through dephosphorylation of signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, His) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Paired immunoglobulin-like type 2 receptor alpha (PILRA) is a immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing member of the paired receptor which consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction such as SH1 through dephosphorylation of signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, His) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-His labeled tag.
Background
Paired immunoglobulin-like type 2 receptor alpha (PILRA) is a immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing member of the paired receptor which consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases like PTPN6/SHP-1 and PTPN11/SHP-2 via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules, while SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. PLPRA is a receptor for PIANP and also acts as an entry co-receptor for herpes simplex virus 1[1][2][3].
Verified Bioactivity
Immobilized Human PILRA, His Tag at 0.5 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-PILRA Antibody, Rabbit IgG Tag with the EC50 of ≤8.9 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
Q9UKJ1-1 (Q20-A197)
-
Molecular Construction
-
N-term
-
PILR-alpha (Q20-A197)
Accession # Q9UKJ1-1 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PILRA; Inhibitory Receptor PILR-Alpha; Paired Immunoglobin Like Type 2 Receptor Alpha; Cell Surface Receptor FDF03; FDF03; Paired Immunoglobin-Like Type 2 Receptor Alpha; Paired Immunoglobulin-Like Type 2 Receptor Alpha
-
AA Sequence
QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETA
-
Predicted Molecular Mass
21.3 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing Tris-Bis PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Fournier N, et al. FDF03, a novel inhibitory receptor of the immunoglobulin superfamily, is expressed by human dendritic and myeloid cells. J Immunol. 2000 Aug 1;165(3):1197-209. [Content Brief]
[2]. Kogure A, et al. PANP is a novel O-glycosylated PILRα ligand expressed in neural tissues. Biochem Biophys Res Commun. 2011 Feb 18;405(3):428-33. [Content Brief]
[3]. Satoh T, et al. PILRalpha is a herpes simplex virus-1 entry coreceptor that associates with glycoprotein B. Cell. 2008 Mar 21;132(6):935-44. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
