1. Recombinant Proteins
  2. Receptor Proteins
  3. PILR-alpha Protein, Human (178a.a, HEK293, His)

PILR-alpha Protein, Human (178a.a, HEK293, His)

Cat. No.: HY-P77142
Handling Instructions Technical Support

Paired immunoglobulin-like type 2 receptor alpha (PILRA) is a immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing member of the paired receptor which consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction such as SH1 through dephosphorylation of signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, His) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Paired immunoglobulin-like type 2 receptor alpha (PILRA) is a immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing member of the paired receptor which consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction such as SH1 through dephosphorylation of signaling molecules. PILR-alpha Protein, Human (178a.a, HEK293, His) is the recombinant human-derived PILR-alpha protein, expressed by HEK293 , with C-His labeled tag.

Background

Paired immunoglobulin-like type 2 receptor alpha (PILRA) is a immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing member of the paired receptor which consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases like PTPN6/SHP-1 and PTPN11/SHP-2 via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules, while SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. PLPRA is a receptor for PIANP and also acts as an entry co-receptor for herpes simplex virus 1[1][2][3].

Biological Activity

Immobilized Human PILRA, His Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-PILRA Antibody, Rabbit IgG Tag with the EC50 of ≤8.9 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-8*His

Accession

Q9UKJ1-1 (Q20-A197)

Gene ID
Molecular Construction
N-term
PILR-alpha (Q20-A197)
Accession # Q9UKJ1-1
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
Paired immunoglobulin-like type 2 receptor alpha; Cell surface receptor FDF03; PILRA
AA Sequence

QPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETA

Molecular Weight

40-50 kDa.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PILR-alpha Protein, Human (178a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PILR-alpha Protein, Human (178a.a, HEK293, His)
Cat. No.:
HY-P77142
Quantity:
MCE Japan Authorized Agent: