PITPNA Protein, Human (His)
PITPNA Protein catalyzes phosphatidylinositol (PI) and phosphatidylcholine (PC) transfer between membranes, displaying a preference for shorter saturated or monosaturated acyl chains at sn-1 and sn-2 positions. For PC, the preference order is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, and for PI, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. PITPNA Protein, Human (His) is the recombinant human-derived PITPNA protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PITPNA Protein catalyzes phosphatidylinositol (PI) and phosphatidylcholine (PC) transfer between membranes, displaying a preference for shorter saturated or monosaturated acyl chains at sn-1 and sn-2 positions. For PC, the preference order is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, and for PI, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. PITPNA Protein, Human (His) is the recombinant human-derived PITPNA protein, expressed by E. coli , with N-6*His labeled tag.
PITPNA protein functions as a catalyst in the transfer of phosphatidylinositol (PI) and phosphatidylcholine (PC) between cellular membranes. This enzyme exhibits a notable preference for PI and PC molecules that possess shorter saturated or monosaturated acyl chains at the sn-1 and sn-2 positions. The preference order for PC substrates is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, while for PI substrates, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. The dynamic lipid transfer mediated by PITPNA contributes to the regulation of lipid composition in cellular membranes, influencing various cellular processes and maintaining membrane homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q00169 (M1-D270)
-
Molecular Construction
-
N-term
-
6*His
-
PITPNA (M1-D270)
Accession # Q00169 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PITPNA; PtdInsTP Alpha; Prev. PITPN; Phosphotidylinositol Transfer Protein; Phosphatidylinositol Transfer Protein Alpha Isoform; Epididymis Secretory Protein Li 36; VIB1A; PI-TPalpha; PtdIns Transfer Protein Alpha; HEL-S-36; Phosphatidylinositol Transfer
-
AA Sequence
MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
-
Predicted Molecular Mass
34 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
