2. Recombinant Proteins
  3. Others
  4. PITPNA Protein, Human (His)

PITPNA Protein catalyzes phosphatidylinositol (PI) and phosphatidylcholine (PC) transfer between membranes, displaying a preference for shorter saturated or monosaturated acyl chains at sn-1 and sn-2 positions. For PC, the preference order is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, and for PI, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. PITPNA Protein, Human (His) is the recombinant human-derived PITPNA protein, expressed by E. coli , with N-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

PITPNA Protein catalyzes phosphatidylinositol (PI) and phosphatidylcholine (PC) transfer between membranes, displaying a preference for shorter saturated or monosaturated acyl chains at sn-1 and sn-2 positions. For PC, the preference order is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, and for PI, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. PITPNA Protein, Human (His) is the recombinant human-derived PITPNA protein, expressed by E. coli , with N-6*His labeled tag.
Background

PITPNA protein functions as a catalyst in the transfer of phosphatidylinositol (PI) and phosphatidylcholine (PC) between cellular membranes. This enzyme exhibits a notable preference for PI and PC molecules that possess shorter saturated or monosaturated acyl chains at the sn-1 and sn-2 positions. The preference order for PC substrates is C16:1 > C16:0 > C18:1 > C18:0 > C20:4, while for PI substrates, it is C16:1 > C16:0 > C18:1 > C18:0 > C20:4 > C20:3. The dynamic lipid transfer mediated by PITPNA contributes to the regulation of lipid composition in cellular membranes, influencing various cellular processes and maintaining membrane homeostasis.
Species

Human
Source

E. coli
Tag

N-6*His
Accession

Q00169 (M1-D270)
Gene ID
Molecular Construction
N-term
6*His
PITPNA (M1-D270)
Accession # Q00169
C-term
Protein Length

Full Length
Synonyms
Phosphatidylinositol Transfer Protein Alpha Isoform; PI-TP-Alpha; PtdIns Transfer Protein Alpha; PtdInsTP Alpha; PITPNA; PITPN
AA Sequence

MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD

Predicted Molecular Mass
34 kDa
분자량

Approximately 16 kDa & 22 kDa & 38 kDa,based on SDS-PAGE under reducing conditions.
Purity

≥ 90%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
각종 서류
Handling Instructions (2659 KB)

PITPNA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

PITPNA Protein, Human (His)

  

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

도

Country or Region *

      

비고

대량구매 문의

Inquiry Information

상품명:
PITPNA Protein, Human (His)
Cat. No.:
HY-P71207
수량:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

상품명

  

Lot #

고객명 *

 

Country or Region *

메일주소 *

     

전화번호 *

 

회사명 *

비고

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.